BLASTX nr result
ID: Ephedra27_contig00027725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00027725 (507 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428878.1| hypothetical protein CICLE_v10011148mg [Citr... 74 2e-11 gb|EOY07747.1| Tetratricopeptide repeat (TPR)-like superfamily p... 74 2e-11 ref|XP_004137961.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_002322855.2| hypothetical protein POPTR_0016s08650g [Popu... 73 4e-11 gb|EXC16278.1| hypothetical protein L484_024452 [Morus notabilis] 72 1e-10 ref|XP_004497462.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_004497461.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 gb|EMJ07627.1| hypothetical protein PRUPE_ppa001926mg [Prunus pe... 72 1e-10 ref|XP_004969633.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 tpg|DAA58005.1| TPA: hypothetical protein ZEAMMB73_979671 [Zea m... 71 1e-10 ref|XP_002456190.1| hypothetical protein SORBIDRAFT_03g031900 [S... 71 1e-10 ref|XP_006664261.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_006663139.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_006407654.1| hypothetical protein EUTSA_v10020113mg [Eutr... 71 2e-10 ref|XP_006296758.1| hypothetical protein CARUB_v10015405mg [Caps... 71 2e-10 ref|NP_187576.1| RNA binding protein HCF152 [Arabidopsis thalian... 71 2e-10 ref|XP_003536980.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_002882632.1| HCF152 [Arabidopsis lyrata subsp. lyrata] gi... 71 2e-10 emb|CBI32614.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 >ref|XP_006428878.1| hypothetical protein CICLE_v10011148mg [Citrus clementina] gi|568853953|ref|XP_006480600.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Citrus sinensis] gi|557530935|gb|ESR42118.1| hypothetical protein CICLE_v10011148mg [Citrus clementina] Length = 740 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/59 (54%), Positives = 45/59 (76%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME++ P NK KY+K++ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 662 MEEHGIPPNKTKYKKIYVEMHSRMFTSKHASQARQDRRRERKRAAEAFKFWLGLPNSYY 720 >gb|EOY07747.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 758 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/59 (54%), Positives = 45/59 (76%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY+K++ + HS ++TSKH S RQ+ R+++KRAAEAFK W+GLPN Y+ Sbjct: 689 MEENGIPPNKTKYKKIYVEMHSRMFTSKHASQARQDRRIERKRAAEAFKFWLGLPNSYY 747 >ref|XP_004137961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Cucumis sativus] gi|449483612|ref|XP_004156638.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Cucumis sativus] Length = 736 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/59 (54%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY +++ + HS ++TSKH S RQ+ R++KKRAAEAFK W+GLPN Y+ Sbjct: 665 MEENGIPPNKTKYSRIYVEMHSRMFTSKHASKARQDRRIEKKRAAEAFKFWLGLPNSYY 723 >ref|XP_002322855.2| hypothetical protein POPTR_0016s08650g [Populus trichocarpa] gi|550321129|gb|EEF04616.2| hypothetical protein POPTR_0016s08650g [Populus trichocarpa] Length = 724 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/59 (54%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY+K++ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 653 MEENGIPPNKTKYKKIYVEMHSRMFTSKHASQARQDRRRERKRAAEAFKFWLGLPNSYY 711 >gb|EXC16278.1| hypothetical protein L484_024452 [Morus notabilis] Length = 749 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY +++ + HS ++TSKH S RQ+ R +KKRAAEAFK W+GLPN Y+ Sbjct: 672 MEENGIPPNKTKYTRIYVEMHSRMFTSKHASQARQDRRREKKRAAEAFKFWLGLPNSYY 730 >ref|XP_004497462.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like isoform X2 [Cicer arietinum] Length = 732 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY +++ + HS ++TSKH S RQ+ R+++KRAAEAFK W+GLPN Y+ Sbjct: 657 MEENGIPPNKTKYTRIYVEMHSRMFTSKHASKARQDRRVERKRAAEAFKFWLGLPNSYY 715 >ref|XP_004497461.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like isoform X1 [Cicer arietinum] Length = 732 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY +++ + HS ++TSKH S RQ+ R+++KRAAEAFK W+GLPN Y+ Sbjct: 657 MEENGIPPNKTKYTRIYVEMHSRMFTSKHASKARQDRRVERKRAAEAFKFWLGLPNSYY 715 >gb|EMJ07627.1| hypothetical protein PRUPE_ppa001926mg [Prunus persica] Length = 740 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK K+ K++ + HS ++TSKH S RQ+ R+++KRAAEAFK W+GLPN Y+ Sbjct: 669 MEENGIPPNKTKFTKIYVEMHSRMFTSKHASQARQDRRIERKRAAEAFKFWLGLPNSYY 727 >ref|XP_004969633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Setaria italica] Length = 734 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ NK +YRKM+ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 659 MEEKGIAPNKTRYRKMYIEMHSRMFTSKHASQARQDRRRERKRAAEAFKFWLGLPNSYY 717 >tpg|DAA58005.1| TPA: hypothetical protein ZEAMMB73_979671 [Zea mays] Length = 730 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ NK KY+KM+ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 656 MEEKGIAPNKTKYKKMYIEMHSRMFTSKHASQARQDRRRERKRAAEAFKFWLGLPNSYY 714 >ref|XP_002456190.1| hypothetical protein SORBIDRAFT_03g031900 [Sorghum bicolor] gi|241928165|gb|EES01310.1| hypothetical protein SORBIDRAFT_03g031900 [Sorghum bicolor] Length = 731 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ NK KY+KM+ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 657 MEEKGIAPNKTKYKKMYIEMHSRMFTSKHASQARQDRRRERKRAAEAFKFWLGLPNSYY 715 >ref|XP_006664261.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Oryza brachyantha] Length = 553 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ NK KY++M+ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 485 MEEMGLEANKGKYKRMYVELHSRMFTSKHASQARQDRRRERKRAAEAFKFWLGLPNSYY 543 >ref|XP_006663139.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like, partial [Oryza brachyantha] Length = 507 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ NK KY++M+ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 438 MEEMGLEANKGKYKRMYVELHSRMFTSKHASQARQDRRRERKRAAEAFKFWLGLPNSYY 496 >ref|XP_006407654.1| hypothetical protein EUTSA_v10020113mg [Eutrema salsugineum] gi|557108800|gb|ESQ49107.1| hypothetical protein EUTSA_v10020113mg [Eutrema salsugineum] Length = 777 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY+K++ + HS ++TSKH S R R+++KRAAEAFK W+GLPN Y+ Sbjct: 708 MEENGIPPNKTKYKKIYVEMHSRMFTSKHASQARVERRVERKRAAEAFKFWLGLPNSYY 766 >ref|XP_006296758.1| hypothetical protein CARUB_v10015405mg [Capsella rubella] gi|482565467|gb|EOA29656.1| hypothetical protein CARUB_v10015405mg [Capsella rubella] Length = 781 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY+K++ + HS ++TSKH S R + R+++KRAAEAFK W+GLPN Y+ Sbjct: 712 MEENGIPPNKTKYKKIYVEMHSRMFTSKHASQARIDRRVERKRAAEAFKFWLGLPNSYY 770 >ref|NP_187576.1| RNA binding protein HCF152 [Arabidopsis thaliana] gi|75204290|sp|Q9SF38.1|PP222_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g09650, chloroplastic; AltName: Full=Protein HIGH CHLOROPHYLL FLUORESCENCE 152; Flags: Precursor gi|6682243|gb|AAF23295.1|AC016661_20 hypothetical protein [Arabidopsis thaliana] gi|332641272|gb|AEE74793.1| RNA binding protein HCF152 [Arabidopsis thaliana] Length = 778 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY+K++ + HS ++TSKH S R + R+++KRAAEAFK W+GLPN Y+ Sbjct: 709 MEENGIPPNKTKYKKIYVEMHSRMFTSKHASQARIDRRVERKRAAEAFKFWLGLPNSYY 767 >ref|XP_003536980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Glycine max] Length = 716 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/60 (50%), Positives = 45/60 (75%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYHE 324 ME+ P NK K+ +++ + HS ++TSKH S RQ+ R+++KRAAEAFK W+GLPN Y++ Sbjct: 638 MEENGIPPNKTKFTRIYVEMHSRMFTSKHASRARQDRRVERKRAAEAFKFWLGLPNSYYD 697 >ref|XP_002882632.1| HCF152 [Arabidopsis lyrata subsp. lyrata] gi|297328472|gb|EFH58891.1| HCF152 [Arabidopsis lyrata subsp. lyrata] Length = 772 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY+K++ + HS ++TSKH S R + R+++KRAAEAFK W+GLPN Y+ Sbjct: 703 MEENGIPPNKTKYKKIYVEMHSRMFTSKHASQARIDRRVERKRAAEAFKFWLGLPNSYY 761 >emb|CBI32614.3| unnamed protein product [Vitis vinifera] Length = 723 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY +++ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 635 MEENGIPPNKSKYTRIYVEMHSRMFTSKHASKARQDRRSERKRAAEAFKFWLGLPNSYY 693 >ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Vitis vinifera] Length = 749 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = -2 Query: 503 MEDYKFPVNKEKYRKMFRKYHSGIYTSKHKSLVRQNARLDKKRAAEAFKLWVGLPNVYH 327 ME+ P NK KY +++ + HS ++TSKH S RQ+ R ++KRAAEAFK W+GLPN Y+ Sbjct: 672 MEENGIPPNKSKYTRIYVEMHSRMFTSKHASKARQDRRSERKRAAEAFKFWLGLPNSYY 730