BLASTX nr result
ID: Ephedra27_contig00027688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00027688 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430220.1| hypothetical protein CICLE_v10011747mg [Citr... 57 3e-06 >ref|XP_006430220.1| hypothetical protein CICLE_v10011747mg [Citrus clementina] gi|557532277|gb|ESR43460.1| hypothetical protein CICLE_v10011747mg [Citrus clementina] Length = 438 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 9/75 (12%) Frame = +3 Query: 147 DDREDYMPIPSAQKLYNAGIRFKKSEGG---EVRFEQGRW------GISHLYLPGIVVDD 299 + E + +P A KL +G++F + +G ++RFE+ +W ++ L +P I VDD Sbjct: 245 EQEEPFKDLPCAAKLQASGVKFNRIKGECLLDIRFEKKKWLGIPSLKVAELQIPQIDVDD 304 Query: 300 NTEDLLRNIMALEEC 344 TE L+RN+MALE+C Sbjct: 305 YTESLMRNVMALEQC 319