BLASTX nr result
ID: Ephedra27_contig00027329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00027329 (422 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003369737.1| ADP-ribosylation factor 1 [Trichinella spira... 55 7e-06 >ref|XP_003369737.1| ADP-ribosylation factor 1 [Trichinella spiralis] gi|316965963|gb|EFV50599.1| ADP-ribosylation factor 1 [Trichinella spiralis] Length = 334 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -2 Query: 148 IRISLRA*DIWMGNSLSSFIS--YGTKDVRILMVGLDGAGKTTILYKLRLG 2 +R++ A MGN +S +G K+VRILMVGLD AGKTTILYKL+LG Sbjct: 131 VRVACEAVHFVMGNLFASLFKGLFGKKEVRILMVGLDAAGKTTILYKLKLG 181