BLASTX nr result
ID: Ephedra27_contig00027316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00027316 (522 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597941.1| hypothetical protein MTR_2g104240 [Medicago ... 57 2e-06 gb|EMJ20585.1| hypothetical protein PRUPE_ppa020228mg [Prunus pe... 57 3e-06 ref|XP_006434030.1| hypothetical protein CICLE_v10003725mg, part... 56 4e-06 emb|CBI32912.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|XP_003597941.1| hypothetical protein MTR_2g104240 [Medicago truncatula] gi|355486989|gb|AES68192.1| hypothetical protein MTR_2g104240 [Medicago truncatula] Length = 78 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 286 IIHQSGAAEAWWAHNPQVPGSKPGSD 209 I +QSGAAEAWWAHNPQVPGSKPGSD Sbjct: 25 ITNQSGAAEAWWAHNPQVPGSKPGSD 50 >gb|EMJ20585.1| hypothetical protein PRUPE_ppa020228mg [Prunus persica] Length = 91 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 277 QSGAAEAWWAHNPQVPGSKPGSDMKSACKLPKTTPFF 167 +SGAAEAWWAHNPQVPGSKPGSDM + PFF Sbjct: 25 RSGAAEAWWAHNPQVPGSKPGSDMSGF----RFKPFF 57 >ref|XP_006434030.1| hypothetical protein CICLE_v10003725mg, partial [Citrus clementina] gi|557536152|gb|ESR47270.1| hypothetical protein CICLE_v10003725mg, partial [Citrus clementina] Length = 121 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 280 HQSGAAEAWWAHNPQVPGSKPGSD 209 +QSGAAEAWWAHNPQVPGSKPGSD Sbjct: 77 NQSGAAEAWWAHNPQVPGSKPGSD 100 >emb|CBI32912.3| unnamed protein product [Vitis vinifera] Length = 42 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 202 ISYQSQVSILGPVGYGPTTLPLRHSD 279 ++YQSQVSILGPVGYGPTTLPLRHSD Sbjct: 12 LTYQSQVSILGPVGYGPTTLPLRHSD 37