BLASTX nr result
ID: Ephedra27_contig00026861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00026861 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002519986.1| ribosomal protein S11 (chloroplast) [Ephedra... 100 2e-19 ref|YP_002519987.1| ribosomal protein L36 (chloroplast) [Ephedra... 79 8e-13 ref|YP_001876610.1| ribosomal protein L36 [Welwitschia mirabilis... 73 4e-11 ref|YP_004891517.1| ribosomal protein L36 (chloroplast) [Taiwani... 66 4e-09 ref|YP_007474822.1| ribosomal protein L36 (chloroplast) [Taxus m... 65 1e-08 ref|YP_004891395.1| ribosomal protein L36 (chloroplast) [Cephalo... 65 1e-08 ref|YP_002519751.1| ribosomal protein L36 [Gnetum parvifolium] g... 65 1e-08 ref|NP_569662.1| ribosomal protein L36 [Psilotum nudum] gi|24212... 64 2e-08 ref|XP_006359987.1| PREDICTED: 50S ribosomal protein L36, chloro... 64 2e-08 ref|YP_001806642.1| ribosomal protein L36 [Cryptomeria japonica]... 64 2e-08 ref|YP_008082133.1| ribosomal protein L36 (chloroplast) [Cunning... 64 2e-08 ref|YP_008081684.1| 50S ribosomal protein L36 (chloroplast) [Cym... 64 3e-08 ref|YP_008081399.1| ribosomal protein L36 (chloroplast) [Tetrace... 63 4e-08 ref|YP_004327696.1| ribosomal protein L36 [Hevea brasiliensis] g... 63 4e-08 ref|YP_001023735.1| ribosomal protein L36 [Angiopteris evecta] g... 63 4e-08 ref|NP_848093.2| ribosomal protein L36 [Adiantum capillus-veneri... 63 5e-08 ref|YP_006503477.1| ribosomal protein L36 (chloroplast) [Gossypi... 62 6e-08 gb|AEZ49391.1| ribosomal protein L36 [Abolboda macrostachya] 62 6e-08 ref|YP_004072496.1| ribosomal protein L36 [Corynocarpus laevigat... 62 6e-08 ref|YP_008994515.1| ribosomal protein L36 (chloroplast) [Hypseoc... 62 8e-08 >ref|YP_002519986.1| ribosomal protein S11 (chloroplast) [Ephedra equisetina] gi|220983587|dbj|BAH11354.1| ribosomal protein S11 (chloroplast) [Ephedra equisetina] Length = 132 Score = 100 bits (249), Expect = 2e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +1 Query: 340 MKPKSMWNLSKNRRIKKEIRRVDRGIIHIQSSFNNTIITVTDVLGHVLS 486 MKPKSMWNLSKNRRIKKEIRRVDRGIIHIQSSFNNTIITVTDVLGHVLS Sbjct: 1 MKPKSMWNLSKNRRIKKEIRRVDRGIIHIQSSFNNTIITVTDVLGHVLS 49 >ref|YP_002519987.1| ribosomal protein L36 (chloroplast) [Ephedra equisetina] gi|220983588|dbj|BAH11355.1| ribosomal protein L36 (chloroplast) [Ephedra equisetina] Length = 37 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG Sbjct: 1 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 37 >ref|YP_001876610.1| ribosomal protein L36 [Welwitschia mirabilis] gi|254798350|sp|B2Y1Z3.1|RK36_WELMI RecName: Full=50S ribosomal protein L36, chloroplastic gi|163311665|gb|ABY26823.1| ribosomal protein L36 [Welwitschia mirabilis] gi|220983426|dbj|BAH11195.1| ribosomal protein L36 (chloroplast) [Welwitschia mirabilis] Length = 37 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MKLRASVRKICSKCRLIRRGKR+YV C+N RHKQKQG Sbjct: 1 MKLRASVRKICSKCRLIRRGKRLYVFCVNARHKQKQG 37 >ref|YP_004891517.1| ribosomal protein L36 (chloroplast) [Taiwania cryptomerioides] gi|512721819|ref|YP_008082434.1| ribosomal protein L36 (chloroplast) [Taiwania flousiana] gi|347977419|dbj|BAK86850.1| ribosomal protein L36 (chloroplast) [Taiwania cryptomerioides] gi|490345292|gb|AGL11280.1| ribosomal protein L36 (chloroplast) [Taiwania flousiana] Length = 37 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK RASVRKIC KCRLIRRGKR+ V+C N RHKQKQG Sbjct: 1 MKTRASVRKICEKCRLIRRGKRLLVICYNPRHKQKQG 37 >ref|YP_007474822.1| ribosomal protein L36 (chloroplast) [Taxus mairei] gi|372863300|gb|AEX99371.1| ribosomal protein L36 (chloroplast) [Taxus mairei] gi|372863377|gb|AEX99447.1| ribosomal protein L36 (chloroplast) [Taxus mairei] gi|372863541|gb|AEX99609.1| ribosomal protein L36 (chloroplast) [Taxus mairei] Length = 37 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRK C KCRLIRRGKR+ V+C N RHKQ+QG Sbjct: 1 MKIRASVRKFCDKCRLIRRGKRLLVICYNPRHKQRQG 37 >ref|YP_004891395.1| ribosomal protein L36 (chloroplast) [Cephalotaxus wilsoniana] gi|501595079|ref|YP_007890279.1| ribosomal protein L36 (chloroplast) [Cephalotaxus oliveri] gi|350529234|dbj|BAL03776.1| ribosomal protein L36 (chloroplast) [Cephalotaxus wilsoniana] gi|429128562|gb|AFZ65578.1| ribosomal protein L36 (chloroplast) [Cephalotaxus oliveri] Length = 37 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRK C KCRLIRRGKR+ V+C N RHKQ+QG Sbjct: 1 MKIRASVRKFCEKCRLIRRGKRLLVICYNPRHKQRQG 37 >ref|YP_002519751.1| ribosomal protein L36 [Gnetum parvifolium] gi|512721607|ref|YP_008082226.1| ribosomal protein L36 (chloroplast) [Gnetum montanum] gi|205829349|sp|A6BM48.1|RK36_GNEPA RecName: Full=50S ribosomal protein L36, chloroplastic gi|149941452|dbj|BAF64893.1| ribosomal protein L36 [Gnetum parvifolium] gi|220983493|dbj|BAH11261.1| ribosomal protein L36 (chloroplast) [Gnetum parvifolium] gi|490345052|gb|AGL11072.1| ribosomal protein L36 (chloroplast) [Gnetum montanum] Length = 37 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKICSKC+LI RGKR+ VVC+N RHKQKQG Sbjct: 1 MKVRASVRKICSKCQLIWRGKRLSVVCVNPRHKQKQG 37 >ref|NP_569662.1| ribosomal protein L36 [Psilotum nudum] gi|24212234|sp|Q8WHY9.1|RK36_PSINU RecName: Full=50S ribosomal protein L36, chloroplastic gi|18389498|dbj|BAB84250.1| ribosomal protein L36 [Psilotum nudum] gi|441018051|gb|AGC26827.1| ribosomal protein L36 (chloroplast) [Psilotum nudum] Length = 37 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR KRI V+C N +HKQKQG Sbjct: 1 MKIRASVRKICEKCRLIRRRKRIMVICFNPKHKQKQG 37 >ref|XP_006359987.1| PREDICTED: 50S ribosomal protein L36, chloroplastic-like [Solanum tuberosum] Length = 40 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +2 Query: 134 NMKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 NMK+RASVRKIC KCRLIRR RI V+C N RHKQKQG Sbjct: 3 NMKIRASVRKICEKCRLIRRRGRIIVICSNPRHKQKQG 40 >ref|YP_001806642.1| ribosomal protein L36 [Cryptomeria japonica] gi|205829325|sp|B1VKC9.1|RK36_CRYJA RecName: Full=50S ribosomal protein L36, chloroplastic gi|171854900|dbj|BAG16640.1| ribosomal protein L36 [Cryptomeria japonica] gi|239794269|dbj|BAH73266.1| ribosomal protein L36 [Cryptomeria japonica] gi|239794351|dbj|BAH73347.1| ribosomal protein L36 [Cryptomeria japonica] Length = 37 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR KR+ V+C N RHKQKQG Sbjct: 1 MKIRASVRKICEKCRLIRRRKRLLVICYNPRHKQKQG 37 >ref|YP_008082133.1| ribosomal protein L36 (chloroplast) [Cunninghamia lanceolata] gi|490344950|gb|AGL10979.1| ribosomal protein L36 (chloroplast) [Cunninghamia lanceolata] Length = 37 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR KR+ V+C N RHKQKQG Sbjct: 1 MKIRASVRKICEKCRLIRRRKRLLVICSNPRHKQKQG 37 >ref|YP_008081684.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium sinense] gi|511943518|ref|YP_008081840.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium tracyanum] gi|511943619|ref|YP_008081918.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium mannii] gi|512721466|ref|YP_008081762.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium tortisepalum] gi|520850555|ref|YP_008081606.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium aloifolium] gi|482662076|gb|AGK25305.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium aloifolium] gi|482662155|gb|AGK25383.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium sinense] gi|482662234|gb|AGK25461.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium tortisepalum] gi|482662313|gb|AGK25539.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium tortisepalum] gi|482662392|gb|AGK25617.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium mannii] gi|482662471|gb|AGK25695.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium tracyanum] gi|482662550|gb|AGK25773.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium tortisepalum] gi|482662629|gb|AGK25851.1| 50S ribosomal protein L36 (chloroplast) [Cymbidium mannii] Length = 37 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR RI V+C NLRHKQ+QG Sbjct: 1 MKIRASVRKICEKCRLIRRRGRIIVICSNLRHKQRQG 37 >ref|YP_008081399.1| ribosomal protein L36 (chloroplast) [Tetracentron sinense] gi|479279237|gb|AGJ72091.1| ribosomal protein L36 (chloroplast) [Tetracentron sinense] Length = 37 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RAS+RKIC KCRLIRR KRI V+C N RHKQ+QG Sbjct: 1 MKIRASIRKICEKCRLIRRRKRIIVICSNPRHKQRQG 37 >ref|YP_004327696.1| ribosomal protein L36 [Hevea brasiliensis] gi|308523540|gb|ADO33590.1| ribosomal protein L36 [Hevea brasiliensis] gi|408900767|gb|AFU95149.1| Rpl36, partial (chloroplast) [Euphorbia maculata] gi|408900803|gb|AFU95167.1| Rpl36, partial (chloroplast) [Pera bumeliifolia] Length = 37 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR RI V+CLN RHKQ+QG Sbjct: 1 MKIRASVRKICEKCRLIRRRGRIIVICLNPRHKQRQG 37 >ref|YP_001023735.1| ribosomal protein L36 [Angiopteris evecta] gi|205829358|sp|A2T367.1|RK36_ANGEV RecName: Full=50S ribosomal protein L36, chloroplastic gi|110628338|gb|ABG79634.1| ribosomal protein L36 [Angiopteris evecta] Length = 37 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR +RI ++CLN +HKQ+QG Sbjct: 1 MKIRASVRKICEKCRLIRRRRRIMIICLNPKHKQRQG 37 >ref|NP_848093.2| ribosomal protein L36 [Adiantum capillus-veneris] gi|68566049|sp|Q85FI9.2|RK36_ADICA RecName: Full=50S ribosomal protein L36, chloroplastic gi|48476026|gb|AAP29424.2| ribosomal protein L36 (chloroplast) [Adiantum capillus-veneris] Length = 37 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RAS+RKIC KCRLIRR +RI V+C N +HKQKQG Sbjct: 1 MKIRASIRKICEKCRLIRRRRRIMVICCNSKHKQKQG 37 >ref|YP_006503477.1| ribosomal protein L36 (chloroplast) [Gossypium capitis-viridis] gi|570758912|ref|YP_008992498.1| ribosomal protein L36 (chloroplast) [Gossypium anomalum] gi|326457071|gb|ADZ74335.1| ribosomal protein L36 [Gossypium anomalum] gi|335354532|gb|AEH43150.1| ribosomal protein L36 (chloroplast) [Gossypium capitis-viridis] Length = 37 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR RI V+C N RHKQ+QG Sbjct: 1 MKIRASVRKICEKCRLIRRRGRIIVICFNTRHKQRQG 37 >gb|AEZ49391.1| ribosomal protein L36 [Abolboda macrostachya] Length = 37 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR +RI V C NL+HKQ+QG Sbjct: 1 MKMRASVRKICGKCRLIRRRRRIIVFCSNLKHKQRQG 37 >ref|YP_004072496.1| ribosomal protein L36 [Corynocarpus laevigata] gi|309252924|gb|ADO60344.1| ribosomal protein L36 [Corynocarpus laevigata] Length = 37 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MK+RASVRKIC KCRLIRR +RI V+C N RHKQ+QG Sbjct: 1 MKIRASVRKICEKCRLIRRRRRIIVICSNPRHKQRQG 37 >ref|YP_008994515.1| ribosomal protein L36 (chloroplast) [Hypseocharis bilobata] gi|540067592|gb|AGV02943.1| ribosomal protein L36 (chloroplast) [Hypseocharis bilobata] Length = 37 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 137 MKLRASVRKICSKCRLIRRGKRIYVVCLNLRHKQKQG 247 MKLRASVRKIC+KCR+IRR +RI V+C N RHKQ+QG Sbjct: 1 MKLRASVRKICNKCRMIRRKRRIRVICPNPRHKQRQG 37