BLASTX nr result
ID: Ephedra27_contig00026288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00026288 (768 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002519996.1| hypothetical protein EpeqC_p062 (chloroplast... 103 5e-20 ref|YP_002519742.1| hypothetical protein GnpaC_p015 [Gnetum parv... 66 1e-08 ref|YP_002519736.1| hypothetical protein GnpaC_p007 [Gnetum parv... 66 1e-08 dbj|BAH11177.1| hypothetical protein (chloroplast) [Welwitschia ... 60 8e-07 ref|YP_001876619.1| hypothetical chloroplast RF2 [Welwitschia mi... 60 8e-07 >ref|YP_002519996.1| hypothetical protein EpeqC_p062 (chloroplast) [Ephedra equisetina] gi|222139940|ref|YP_002520008.1| hypothetical protein EpeqC_p074 (chloroplast) [Ephedra equisetina] gi|220983597|dbj|BAH11364.1| hypothetical protein (chloroplast) [Ephedra equisetina] gi|220983609|dbj|BAH11376.1| hypothetical protein (chloroplast) [Ephedra equisetina] Length = 2125 Score = 103 bits (258), Expect = 5e-20 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = +1 Query: 13 LFHFCRLKPIVLKRIDKLTLLLTNPNQISANNTFAFAQSLFSELHKNRLRNQIFDTDKQ 189 LFHFCRLKPIVLKR D+ TLLLTNPNQ+SANNTFAFAQSLF ELHKNRL NQIFD K+ Sbjct: 323 LFHFCRLKPIVLKRTDRFTLLLTNPNQVSANNTFAFAQSLFYELHKNRLGNQIFDHRKK 381 >ref|YP_002519742.1| hypothetical protein GnpaC_p015 [Gnetum parvifolium] gi|512721616|ref|YP_008082235.1| hypothetical protein (chloroplast) [Gnetum montanum] gi|512721622|ref|YP_008082241.1| hypothetical protein (chloroplast) [Gnetum montanum] gi|220983484|dbj|BAH11252.1| hypothetical protein (chloroplast) [Gnetum parvifolium] gi|490345061|gb|AGL11081.1| hypothetical protein (chloroplast) [Gnetum montanum] gi|490345067|gb|AGL11087.1| hypothetical protein (chloroplast) [Gnetum montanum] Length = 2185 Score = 66.2 bits (160), Expect = 1e-08 Identities = 35/61 (57%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Frame = +1 Query: 13 LFHFCRLKPIVLKRIDKLTLLLTNPNQISANNTF--AFAQSLFSELHKNRLRNQIFDTDK 186 LF FCRLKPIVLKR D+ TL LTNP+Q+SAN + + LF EL K +L NQIF K Sbjct: 358 LFGFCRLKPIVLKRTDRFTLSLTNPSQVSANTSAFDIYYSKLFDELQKQKLWNQIFHHRK 417 Query: 187 Q 189 + Sbjct: 418 K 418 >ref|YP_002519736.1| hypothetical protein GnpaC_p007 [Gnetum parvifolium] gi|220983478|dbj|BAH11246.1| hypothetical protein (chloroplast) [Gnetum parvifolium] Length = 2185 Score = 66.2 bits (160), Expect = 1e-08 Identities = 35/61 (57%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Frame = +1 Query: 13 LFHFCRLKPIVLKRIDKLTLLLTNPNQISANNTF--AFAQSLFSELHKNRLRNQIFDTDK 186 LF FCRLKPIVLKR D+ TL LTNP+Q+SAN + + LF EL K +L NQIF K Sbjct: 358 LFGFCRLKPIVLKRTDRFTLSLTNPSQVSANTSAFDIYYSKLFDELQKQKLWNQIFHHRK 417 Query: 187 Q 189 + Sbjct: 418 K 418 >dbj|BAH11177.1| hypothetical protein (chloroplast) [Welwitschia mirabilis] gi|220983417|dbj|BAH11186.1| hypothetical protein (chloroplast) [Welwitschia mirabilis] Length = 2266 Score = 60.1 bits (144), Expect = 8e-07 Identities = 34/57 (59%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = +1 Query: 13 LFHFCRLKPIVLKRIDKLTLLLTNPNQISANNTFAF---AQSLFSELHKNRLRNQIF 174 LFHFCRLKPIVLKR D+ TL LTNP+++SA TFAF L E+ R NQIF Sbjct: 337 LFHFCRLKPIVLKRTDRFTLSLTNPSRVSA-KTFAFDIETPHLSYEIPYKRFWNQIF 392 >ref|YP_001876619.1| hypothetical chloroplast RF2 [Welwitschia mirabilis] gi|187763154|ref|YP_001876628.1| hypothetical chloroplast RF2 [Welwitschia mirabilis] gi|163311674|gb|ABY26832.1| hypothetical chloroplast RF2 [Welwitschia mirabilis] gi|163311684|gb|ABY26842.1| hypothetical chloroplast RF2 [Welwitschia mirabilis] Length = 2266 Score = 60.1 bits (144), Expect = 8e-07 Identities = 34/57 (59%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = +1 Query: 13 LFHFCRLKPIVLKRIDKLTLLLTNPNQISANNTFAF---AQSLFSELHKNRLRNQIF 174 LFHFCRLKPIVLKR D+ TL LTNP+++SA TFAF L E+ R NQIF Sbjct: 337 LFHFCRLKPIVLKRTDRFTLSLTNPSRVSA-KTFAFDIETPHLSYEIPYKRFWNQIF 392