BLASTX nr result
ID: Ephedra27_contig00026254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00026254 (396 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430220.1| hypothetical protein CICLE_v10011747mg [Citr... 57 3e-06 >ref|XP_006430220.1| hypothetical protein CICLE_v10011747mg [Citrus clementina] gi|557532277|gb|ESR43460.1| hypothetical protein CICLE_v10011747mg [Citrus clementina] Length = 438 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/92 (33%), Positives = 51/92 (55%), Gaps = 15/92 (16%) Frame = -3 Query: 247 KPYMPIPSAQKLYNAGIRFKTSEGG---EVRFEQGRW------GISHMYLPRIIVDDNTE 95 +P+ +P A KL +G++F +G ++RFE+ +W ++ + +P+I VDD TE Sbjct: 248 EPFKDLPCAAKLQASGVKFNRIKGECLLDIRFEKKKWLGIPSLKVAELQIPQIDVDDYTE 307 Query: 94 NLLRNIMVLEEC------LACKSTPLGDKRCD 17 +L+RN+M LE+C C L DK D Sbjct: 308 SLMRNVMALEQCRYPRKAFVCNYVDLMDKLID 339