BLASTX nr result
ID: Ephedra27_contig00026178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00026178 (534 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001757667.1| predicted protein [Physcomitrella patens] gi... 60 4e-07 ref|XP_006842308.1| hypothetical protein AMTR_s00079p00125070 [A... 58 2e-06 ref|XP_002276472.2| PREDICTED: uncharacterized protein LOC100252... 56 6e-06 emb|CBI15461.3| unnamed protein product [Vitis vinifera] 56 6e-06 emb|CAN84081.1| hypothetical protein VITISV_005220 [Vitis vinifera] 56 6e-06 ref|XP_002532158.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_001757667.1| predicted protein [Physcomitrella patens] gi|162691361|gb|EDQ77724.1| predicted protein [Physcomitrella patens] Length = 689 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +3 Query: 393 SGNRKWVAGLSSLANVVVGQCANVLLLSTDDLKQNFEAEASDNIKHP 533 SG RKW+ LSSLANVVVG CA +L L ++L+++FE EA + KHP Sbjct: 32 SGTRKWIKELSSLANVVVGHCARILQLHPEELQRHFEEEAPTSAKHP 78 >ref|XP_006842308.1| hypothetical protein AMTR_s00079p00125070 [Amborella trichopoda] gi|548844374|gb|ERN03983.1| hypothetical protein AMTR_s00079p00125070 [Amborella trichopoda] Length = 690 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +3 Query: 393 SGNRKWVAGLSSLANVVVGQCANVLLLSTDDLKQNFEAEASDNIKHP 533 SG RK ++ LS LANVVVG+C+ +L +S D+L+Q+F EAS +IKHP Sbjct: 42 SGRRKCISELSPLANVVVGRCSRILDVSMDELQQHFNLEASGSIKHP 88 >ref|XP_002276472.2| PREDICTED: uncharacterized protein LOC100252490 [Vitis vinifera] Length = 657 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = +3 Query: 393 SGNRKWVAGLSSLANVVVGQCANVLLLSTDDLKQNFEAEASDNIKHP 533 S + W+ LS +AN+VV +C+ +L +ST +L+++F+AEASD+IKHP Sbjct: 42 SARKNWIQELSPVANIVVRRCSKILGISTMELRESFDAEASDSIKHP 88 >emb|CBI15461.3| unnamed protein product [Vitis vinifera] Length = 723 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = +3 Query: 393 SGNRKWVAGLSSLANVVVGQCANVLLLSTDDLKQNFEAEASDNIKHP 533 S + W+ LS +AN+VV +C+ +L +ST +L+++F+AEASD+IKHP Sbjct: 42 SARKNWIQELSPVANIVVRRCSKILGISTMELRESFDAEASDSIKHP 88 >emb|CAN84081.1| hypothetical protein VITISV_005220 [Vitis vinifera] Length = 691 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = +3 Query: 393 SGNRKWVAGLSSLANVVVGQCANVLLLSTDDLKQNFEAEASDNIKHP 533 S + W+ LS +AN+VV +C+ +L +ST +L+++F+AEASD+IKHP Sbjct: 40 SARKNWIQELSPVANIVVRRCSKILGISTMELRESFDAEASDSIKHP 86 >ref|XP_002532158.1| conserved hypothetical protein [Ricinus communis] gi|223528168|gb|EEF30232.1| conserved hypothetical protein [Ricinus communis] Length = 739 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/47 (46%), Positives = 36/47 (76%) Frame = +3 Query: 393 SGNRKWVAGLSSLANVVVGQCANVLLLSTDDLKQNFEAEASDNIKHP 533 S +R W+A LS LAN++V +C+ +L +S +L+++F EASD++KHP Sbjct: 42 SASRSWIAELSPLANMIVRRCSKILGISASELQESFNVEASDSVKHP 88