BLASTX nr result
ID: Ephedra27_contig00025943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025943 (356 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530572.1| DNA polymerase I, putative [Ricinus communis... 56 4e-06 >ref|XP_002530572.1| DNA polymerase I, putative [Ricinus communis] gi|223529871|gb|EEF31802.1| DNA polymerase I, putative [Ricinus communis] Length = 246 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/58 (43%), Positives = 35/58 (60%) Frame = -1 Query: 356 LRSNLPYYILPFKTSDFLLEKPKDGEEKLMQILQSIRMVQDGYSVATAASRLSRFWEK 183 LRS+LP+Y++PF T DF EKP+D EK M +L +I + G+S R W+K Sbjct: 185 LRSDLPFYMVPFSTKDFTFEKPEDDGEKFMNLLNAISVYAKGFSADPIIRRALYLWKK 242