BLASTX nr result
ID: Ephedra27_contig00025738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025738 (462 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002988183.1| hypothetical protein SELMODRAFT_426921 [Sela... 68 1e-09 ref|XP_002963472.1| hypothetical protein SELMODRAFT_80545 [Selag... 62 1e-07 >ref|XP_002988183.1| hypothetical protein SELMODRAFT_426921 [Selaginella moellendorffii] gi|300143915|gb|EFJ10602.1| hypothetical protein SELMODRAFT_426921 [Selaginella moellendorffii] Length = 154 Score = 67.8 bits (164), Expect = 1e-09 Identities = 36/75 (48%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Frame = +3 Query: 3 ASSYWLRNLPSDYKIPSALSPDHEVEKWIRDKYERRLFCDQG-PPPEFMGQQLSQPVVPI 179 AS+YW + LP + PS SPD EVE+WIRDKYE+RLFC PPPE P I Sbjct: 86 ASAYWEQRLPQGIQRPSPESPDSEVERWIRDKYEKRLFCPPDLPPPE-------APKFAI 138 Query: 180 PILVEDVNSEEWSPF 224 V S +W PF Sbjct: 139 EETGASVRSSDWKPF 153 >ref|XP_002963472.1| hypothetical protein SELMODRAFT_80545 [Selaginella moellendorffii] gi|300168740|gb|EFJ35343.1| hypothetical protein SELMODRAFT_80545 [Selaginella moellendorffii] Length = 158 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +3 Query: 3 ASSYWLRNLPSDYKIPSALSPDHEVEKWIRDKYERRLFCDQG-PPPE 140 A++YW + LP + PS SPD EVE+WIRDKYE+RLFC PPPE Sbjct: 90 AAAYWEQRLPQGIQRPSPESPDSEVERWIRDKYEKRLFCPPDLPPPE 136