BLASTX nr result
ID: Ephedra27_contig00025669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025669 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG73245.1| class III HD-Zip protein HDZ31 [Pinus taeda] 75 9e-14 dbj|BAL02986.1| class III homeodomain-leucine zipper protein, pa... 74 9e-14 gb|ACA33848.1| class III HD-Zip transcription factor HDZ31 [Pinu... 75 9e-14 gb|ACA33840.1| class III HD-Zip transcription factor HDZ31 [Pinu... 75 1e-13 gb|AGM34021.1| class III homeodomain leucine zipper protein 31 [... 75 2e-13 gb|ABD75309.1| class III homeodomain-leucine zipper protein C3HD... 75 2e-13 gb|ADV04322.1| class III homeodomain leucine zipper protein [Pic... 74 2e-13 gb|ABB93543.1| homeodomain-leucine zipper trancription factor HB... 74 2e-13 gb|ABB93495.1| homeodomain-leucine zipper trancription factor HB... 74 2e-13 gb|ABB94099.1| homeodomain-leucine zipper trancription factor HB... 74 2e-13 gb|ABB94031.1| homeodomain-leucine zipper trancription factor HB... 74 2e-13 gb|ABB93496.1| homeodomain-leucine zipper trancription factor HB... 74 2e-13 gb|ABD90526.1| class III homeodomain-leucine zipper [Ginkgo biloba] 73 2e-13 gb|ABD75306.1| class III homeodomain-leucine zipper protein C3HD... 73 2e-13 gb|ABD75311.1| class III homeodomain-leucine zipper protein C3HD... 72 6e-13 gb|ABD90527.1| class III homeodomain-leucine zipper [Pseudotsuga... 75 9e-13 ref|XP_006846015.1| hypothetical protein AMTR_s00155p00069240 [A... 61 2e-11 gb|ABG73250.1| class III HD-Zip protein HDZ31 [Ginkgo biloba] 73 3e-11 gb|EOY25496.1| Homeobox-leucine zipper family protein / lipid-bi... 60 5e-11 gb|EOY25492.1| Homeobox-leucine zipper family protein / lipid-bi... 60 5e-11 >gb|ABG73245.1| class III HD-Zip protein HDZ31 [Pinus taeda] Length = 842 Score = 74.7 bits (182), Expect(2) = 9e-14 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 418 Score = 27.3 bits (59), Expect(2) = 9e-14 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >dbj|BAL02986.1| class III homeodomain-leucine zipper protein, partial [Gnetum parvifolium] Length = 705 Score = 73.9 bits (180), Expect(2) = 9e-14 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAAMRR QIAQ++SGEVVFGW R PAVLRTFS LSRGF E VN F+D+G ++M Sbjct: 305 IAAMRRLRQIAQESSGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFADEGWSIM 359 Score = 28.1 bits (61), Expect(2) = 9e-14 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -1 Query: 225 DEIIEDFSVEINPLNIQNI-VNYQSFSSFG--GAILYAKCYMLLQIVPKYRIILLVFLWE 55 D +ED ++ IN ++ +FS FG G IL AK MLLQ VP +L+ FL E Sbjct: 363 DGSVEDVTISINSSPTKHASAAAAAFSVFGSGGGILCAKSSMLLQNVPP--ALLIRFLRE 420 >gb|ACA33848.1| class III HD-Zip transcription factor HDZ31 [Pinus taeda] Length = 590 Score = 74.7 bits (182), Expect(2) = 9e-14 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 174 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 228 Score = 27.3 bits (59), Expect(2) = 9e-14 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 233 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 288 >gb|ACA33840.1| class III HD-Zip transcription factor HDZ31 [Pinus pinaster] Length = 628 Score = 74.7 bits (182), Expect(2) = 1e-13 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 209 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 263 Score = 26.9 bits (58), Expect(2) = 1e-13 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQ-----SFSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ YQ ++ GG IL AK MLLQ VP +L+ FL E Sbjct: 268 VEDVTIAINSSPNKHFA-YQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 323 >gb|AGM34021.1| class III homeodomain leucine zipper protein 31 [Larix kaempferi] Length = 842 Score = 74.7 bits (182), Expect(2) = 2e-13 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 418 Score = 26.6 bits (57), Expect(2) = 2e-13 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNI---VNYQS-FSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ VN + ++ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFGSQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ABD75309.1| class III homeodomain-leucine zipper protein C3HDZ1 [Pseudotsuga menziesii] Length = 842 Score = 74.7 bits (182), Expect(2) = 2e-13 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 418 Score = 26.6 bits (57), Expect(2) = 2e-13 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNI---VNYQS-FSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ VN + ++ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFGSQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ADV04322.1| class III homeodomain leucine zipper protein [Picea glauca] Length = 842 Score = 73.6 bits (179), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG +++ Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLL 418 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ABB93543.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908758|gb|ABB93549.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908766|gb|ABB93553.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908776|gb|ABB93558.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908792|gb|ABB93566.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908814|gb|ABB93577.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908824|gb|ABB93582.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908842|gb|ABB93591.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] Length = 842 Score = 73.6 bits (179), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG +++ Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLL 418 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ABB93495.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908654|gb|ABB93497.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908656|gb|ABB93498.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908658|gb|ABB93499.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908660|gb|ABB93500.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908662|gb|ABB93501.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908664|gb|ABB93502.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908666|gb|ABB93503.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908668|gb|ABB93504.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908670|gb|ABB93505.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908672|gb|ABB93506.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908674|gb|ABB93507.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908676|gb|ABB93508.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908678|gb|ABB93509.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908680|gb|ABB93510.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908682|gb|ABB93511.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908684|gb|ABB93512.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908686|gb|ABB93513.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908688|gb|ABB93514.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908690|gb|ABB93515.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908692|gb|ABB93516.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908694|gb|ABB93517.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908696|gb|ABB93518.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908698|gb|ABB93519.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908700|gb|ABB93520.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908702|gb|ABB93521.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908704|gb|ABB93522.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908706|gb|ABB93523.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908708|gb|ABB93524.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908710|gb|ABB93525.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908712|gb|ABB93526.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908714|gb|ABB93527.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908716|gb|ABB93528.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908718|gb|ABB93529.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908720|gb|ABB93530.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908722|gb|ABB93531.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908724|gb|ABB93532.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908726|gb|ABB93533.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908728|gb|ABB93534.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908730|gb|ABB93535.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908732|gb|ABB93536.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908734|gb|ABB93537.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908736|gb|ABB93538.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908738|gb|ABB93539.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908740|gb|ABB93540.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908742|gb|ABB93541.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908744|gb|ABB93542.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908748|gb|ABB93544.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908750|gb|ABB93545.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908752|gb|ABB93546.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908754|gb|ABB93547.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908756|gb|ABB93548.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908760|gb|ABB93550.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908762|gb|ABB93551.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908764|gb|ABB93552.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908768|gb|ABB93554.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908770|gb|ABB93555.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908772|gb|ABB93556.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908774|gb|ABB93557.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908778|gb|ABB93559.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908780|gb|ABB93560.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908782|gb|ABB93561.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908784|gb|ABB93562.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908786|gb|ABB93563.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908788|gb|ABB93564.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908790|gb|ABB93565.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908794|gb|ABB93567.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908796|gb|ABB93568.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908798|gb|ABB93569.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908800|gb|ABB93570.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908802|gb|ABB93571.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908804|gb|ABB93572.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908806|gb|ABB93573.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908808|gb|ABB93574.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908810|gb|ABB93575.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908812|gb|ABB93576.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908816|gb|ABB93578.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908818|gb|ABB93579.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908820|gb|ABB93580.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908822|gb|ABB93581.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908826|gb|ABB93583.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908828|gb|ABB93584.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908830|gb|ABB93585.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908832|gb|ABB93586.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908834|gb|ABB93587.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908836|gb|ABB93588.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908838|gb|ABB93589.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908840|gb|ABB93590.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908844|gb|ABB93592.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82909691|gb|ABB94009.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909693|gb|ABB94010.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909695|gb|ABB94011.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909697|gb|ABB94012.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909699|gb|ABB94013.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909701|gb|ABB94014.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909703|gb|ABB94015.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909705|gb|ABB94016.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909707|gb|ABB94017.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909709|gb|ABB94018.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909711|gb|ABB94019.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909713|gb|ABB94020.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909715|gb|ABB94021.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909717|gb|ABB94022.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909719|gb|ABB94023.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909721|gb|ABB94024.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909723|gb|ABB94025.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909725|gb|ABB94026.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909727|gb|ABB94027.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909729|gb|ABB94028.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909731|gb|ABB94029.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909733|gb|ABB94030.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909737|gb|ABB94032.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909739|gb|ABB94033.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909741|gb|ABB94034.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909743|gb|ABB94035.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909745|gb|ABB94036.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909747|gb|ABB94037.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909749|gb|ABB94038.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909751|gb|ABB94039.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909753|gb|ABB94040.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909755|gb|ABB94041.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909757|gb|ABB94042.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909759|gb|ABB94043.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909761|gb|ABB94044.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909763|gb|ABB94045.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909765|gb|ABB94046.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909767|gb|ABB94047.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909769|gb|ABB94048.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909771|gb|ABB94049.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909773|gb|ABB94050.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909775|gb|ABB94051.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909777|gb|ABB94052.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909779|gb|ABB94053.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909781|gb|ABB94054.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909783|gb|ABB94055.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909785|gb|ABB94056.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909787|gb|ABB94057.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909789|gb|ABB94058.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909791|gb|ABB94059.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909793|gb|ABB94060.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909795|gb|ABB94061.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909797|gb|ABB94062.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909799|gb|ABB94063.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909801|gb|ABB94064.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909803|gb|ABB94065.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909805|gb|ABB94066.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909807|gb|ABB94067.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909809|gb|ABB94068.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909811|gb|ABB94069.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909813|gb|ABB94070.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909815|gb|ABB94071.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909817|gb|ABB94072.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909819|gb|ABB94073.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909821|gb|ABB94074.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909823|gb|ABB94075.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909825|gb|ABB94076.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909827|gb|ABB94077.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909829|gb|ABB94078.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909831|gb|ABB94079.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909833|gb|ABB94080.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909835|gb|ABB94081.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909837|gb|ABB94082.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909839|gb|ABB94083.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909841|gb|ABB94084.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909843|gb|ABB94085.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909845|gb|ABB94086.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909847|gb|ABB94087.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909849|gb|ABB94088.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909851|gb|ABB94089.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909853|gb|ABB94090.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909855|gb|ABB94091.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909857|gb|ABB94092.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909859|gb|ABB94093.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909861|gb|ABB94094.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909863|gb|ABB94095.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909865|gb|ABB94096.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909867|gb|ABB94097.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909869|gb|ABB94098.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909873|gb|ABB94100.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909875|gb|ABB94101.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909877|gb|ABB94102.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909879|gb|ABB94103.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909881|gb|ABB94104.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909883|gb|ABB94105.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909885|gb|ABB94106.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909887|gb|ABB94107.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909889|gb|ABB94108.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909891|gb|ABB94109.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909893|gb|ABB94110.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909895|gb|ABB94111.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909897|gb|ABB94112.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909899|gb|ABB94113.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909901|gb|ABB94114.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909903|gb|ABB94115.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909905|gb|ABB94116.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909907|gb|ABB94117.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909909|gb|ABB94118.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909911|gb|ABB94119.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909913|gb|ABB94120.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909915|gb|ABB94121.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909917|gb|ABB94122.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909919|gb|ABB94123.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909921|gb|ABB94124.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909923|gb|ABB94125.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909925|gb|ABB94126.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909927|gb|ABB94127.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909929|gb|ABB94128.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 73.6 bits (179), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG +++ Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLL 418 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ABB94099.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 73.6 bits (179), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG +++ Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLL 418 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ABB94031.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 73.6 bits (179), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG +++ Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLL 418 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ABB93496.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] Length = 842 Score = 73.6 bits (179), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG +++ Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLL 418 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNIVNYQSFSS----FGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ + + S+ GG IL AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFASQVNASNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 478 >gb|ABD90526.1| class III homeodomain-leucine zipper [Ginkgo biloba] Length = 842 Score = 73.2 bits (178), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+ +GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 363 IAALRRIRQIAQEVTGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 417 Score = 27.7 bits (60), Expect(2) = 2e-13 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = -1 Query: 234 MNNDEIIEDFSVEINP----LNIQNIVNYQSFSSFGGAILYAKCYMLLQIVPKYRIILLV 67 M ND + ED ++ IN L + + ++ GG IL AK MLLQ VP +L+ Sbjct: 417 MGNDGM-EDVTIAINSSPSKLLGSQVNSSNGLTAVGGGILCAKASMLLQNVPP--ALLVR 473 Query: 66 FLWE 55 FL E Sbjct: 474 FLRE 477 >gb|ABD75306.1| class III homeodomain-leucine zipper protein C3HDZ1 [Ginkgo biloba] Length = 842 Score = 73.2 bits (178), Expect(2) = 2e-13 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+ +GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 363 IAALRRIRQIAQEVTGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 417 Score = 27.7 bits (60), Expect(2) = 2e-13 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = -1 Query: 234 MNNDEIIEDFSVEINP----LNIQNIVNYQSFSSFGGAILYAKCYMLLQIVPKYRIILLV 67 M ND + ED ++ IN L + + ++ GG IL AK MLLQ VP +L+ Sbjct: 417 MGNDGM-EDVTIAINSSPSKLLGSQVNSSNGLTAVGGGILCAKASMLLQNVPP--ALLVR 473 Query: 66 FLWE 55 FL E Sbjct: 474 FLRE 477 >gb|ABD75311.1| class III homeodomain-leucine zipper protein C3HDZ1 [Taxus globosa] Length = 837 Score = 72.0 bits (175), Expect(2) = 6e-13 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+ +GEVVFGW R PAVLRTFS LSRGF E VN F+DDG + M Sbjct: 360 IAALRRLRQIAQEVTGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSSM 414 Score = 27.3 bits (59), Expect(2) = 6e-13 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINP----LNIQNIVNYQSFSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN L + + ++ GG IL AK MLLQ VP +L+ FL E Sbjct: 419 VEDVTIVINSSPSKLVGSQVNSSNGLTTLGGGILCAKASMLLQNVPP--ALLVRFLRE 474 >gb|ABD90527.1| class III homeodomain-leucine zipper [Pseudotsuga menziesii] Length = 842 Score = 74.7 bits (182), Expect(2) = 9e-13 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+A+GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 364 IAALRRLRQIAQEATGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 418 Score = 23.9 bits (50), Expect(2) = 9e-13 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINPLNIQNI---VNYQS-FSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN ++ VN + ++ GG I AK MLLQ VP +L+ FL E Sbjct: 423 VEDVTIAINSSPNKHFGSQVNASNGLTTLGGGIPCAKASMLLQNVPP--ALLVRFLRE 478 >ref|XP_006846015.1| hypothetical protein AMTR_s00155p00069240 [Amborella trichopoda] gi|548848771|gb|ERN07690.1| hypothetical protein AMTR_s00155p00069240 [Amborella trichopoda] Length = 844 Score = 61.2 bits (147), Expect(2) = 2e-11 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 +AA+R QIA +ASGEV +G R PAVLRTFS LSRGF + VN F+DDG ++M Sbjct: 366 LAALRHIRQIAHEASGEVNYGGGRQPAVLRTFSQRLSRGFNDAVNGFADDGWSLM 420 Score = 33.1 bits (74), Expect(2) = 2e-11 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Frame = -1 Query: 216 IEDFSVEINP----LNIQNIVNYQSFSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ +N L N+ + + S+FGG IL AK MLLQ VP +L+ FL E Sbjct: 425 VEDVTIVLNTNPSKLFAANVNSAAAISTFGGGILCAKASMLLQNVPP--ALLVRFLRE 480 >gb|ABG73250.1| class III HD-Zip protein HDZ31 [Ginkgo biloba] Length = 394 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+RR QIAQ+ +GEVVFGW R PAVLRTFS LSRGF E VN F+DDG ++M Sbjct: 299 IAALRRIRQIAQEVTGEVVFGWGRQPAVLRTFSQRLSRGFNEAVNGFTDDGWSLM 353 >gb|EOY25496.1| Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein isoform 5 [Theobroma cacao] Length = 848 Score = 60.5 bits (145), Expect(2) = 5e-11 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+R QIAQ+ SGE+ +G R PAVLRTFS L RGF + VN F+DDG ++M Sbjct: 369 IAALRHIRQIAQETSGEIQYGGGRQPAVLRTFSQRLCRGFNDAVNGFADDGWSLM 423 Score = 32.3 bits (72), Expect(2) = 5e-11 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -1 Query: 216 IEDFSVEINPLN---IQNIVNYQSFSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN + + N F SFGG +L AK MLLQ VP +L+ FL E Sbjct: 428 VEDVTIMINSSPGKFLGSQYNTSMFPSFGGGVLCAKASMLLQNVPP--ALLVRFLRE 482 >gb|EOY25492.1| Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein isoform 1 [Theobroma cacao] Length = 843 Score = 60.5 bits (145), Expect(2) = 5e-11 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 386 IAAMRR*GQIAQKASGEVVFGWRR*PAVLRTFSWWLSRGFLEVVNDFSDDG*TMM 222 IAA+R QIAQ+ SGE+ +G R PAVLRTFS L RGF + VN F+DDG ++M Sbjct: 355 IAALRHIRQIAQETSGEIQYGGGRQPAVLRTFSQRLCRGFNDAVNGFADDGWSLM 409 Score = 32.3 bits (72), Expect(2) = 5e-11 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -1 Query: 216 IEDFSVEINPLN---IQNIVNYQSFSSFGGAILYAKCYMLLQIVPKYRIILLVFLWE 55 +ED ++ IN + + N F SFGG +L AK MLLQ VP +L+ FL E Sbjct: 414 VEDVTIMINSSPGKFLGSQYNTSMFPSFGGGVLCAKASMLLQNVPP--ALLVRFLRE 468