BLASTX nr result
ID: Ephedra27_contig00025664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025664 (588 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579338.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 >ref|XP_003579338.1| PREDICTED: pentatricopeptide repeat-containing protein At3g20730-like [Brachypodium distachyon] Length = 558 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 2/95 (2%) Frame = +3 Query: 207 MITVYNTSGLTKEELGLYRNMMG*RIMPNDFTYVSILSCISRIDILPRGQQVHPSALKGG 386 M++ Y+ +G T+E L L+ M+ + PN FTY S+ S + + G+QVH KG Sbjct: 83 MVSGYSRNGQTREALDLFTLMLASGVRPNQFTYGSVASACAGAGCVRSGEQVHACVAKGR 142 Query: 387 FFSDGFMRSGILDANLE--DLGDVC*VFDEIPRFD 485 F D F++S ++D +L + D +F E+ R D Sbjct: 143 FVGDVFVQSALMDMHLRCGSVVDAMQLFAEMERKD 177