BLASTX nr result
ID: Ephedra27_contig00025503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025503 (428 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24197.1| Cyclin-dependent kinase inhibitor 3 [Morus notabi... 64 2e-08 emb|CBI17323.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002268785.1| PREDICTED: cyclin-dependent kinase inhibitor... 64 2e-08 emb|CAN70215.1| hypothetical protein VITISV_012042 [Vitis vinifera] 64 2e-08 ref|XP_002521100.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 ref|XP_002301783.1| hypothetical protein POPTR_0002s24360g [Popu... 63 3e-08 gb|AEZ35251.1| cyclin-dependent kinase inhibitor [Persea americana] 62 6e-08 ref|XP_006443609.1| hypothetical protein CICLE_v10022181mg [Citr... 62 1e-07 gb|EOY05315.1| Cyclin dependent kinase inhibitor, putative [Theo... 62 1e-07 gb|EMJ00561.1| hypothetical protein PRUPE_ppa025388mg [Prunus pe... 61 2e-07 ref|XP_006369798.1| hypothetical protein POPTR_0001s32120g [Popu... 60 2e-07 ref|NP_001048905.1| Os03g0137800 [Oryza sativa Japonica Group] g... 60 2e-07 gb|EAZ25508.1| hypothetical protein OsJ_09332 [Oryza sativa Japo... 60 2e-07 ref|XP_006349933.1| PREDICTED: cyclin-dependent kinase inhibitor... 60 3e-07 ref|XP_002518110.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 gb|EAY88461.1| hypothetical protein OsI_09928 [Oryza sativa Indi... 60 4e-07 gb|EXC16926.1| Cyclin-dependent kinase inhibitor 4 [Morus notabi... 59 7e-07 ref|XP_004296651.1| PREDICTED: cyclin-dependent kinase inhibitor... 59 7e-07 ref|XP_004253000.1| PREDICTED: cyclin-dependent kinase inhibitor... 59 7e-07 ref|XP_006395120.1| hypothetical protein EUTSA_v10004871mg [Eutr... 59 9e-07 >gb|EXC24197.1| Cyclin-dependent kinase inhibitor 3 [Morus notabilis] Length = 248 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP + + PGSTT+ K A + + + P++HEM++FFA AEQ Q+ Sbjct: 161 RESTPCSLIRGSDTVGTPGSTTRQKSYTATSQRVRNDMQRSIPTAHEMDEFFAFAEQQQQ 220 Query: 381 RVFIERYNYDPVTDLP 428 R+FIE+YN+D V D P Sbjct: 221 RIFIEKYNFDIVKDSP 236 >emb|CBI17323.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RE+TP + + PGSTTK D R+G+ P++ EM+ FF AE+ Q+ Sbjct: 116 RETTPCSLIRDPETIRTPGSTTKPASSSGINRRMDNSRQGHVPTTQEMDQFFQSAEEEQQ 175 Query: 381 RVFIERYNYDPVTDLP 428 RVF ++YN+DPV D P Sbjct: 176 RVFTDKYNFDPVNDKP 191 >ref|XP_002268785.1| PREDICTED: cyclin-dependent kinase inhibitor 5 [Vitis vinifera] Length = 263 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RE+TP + + PGSTTK D R+G+ P++ EM+ FF AE+ Q+ Sbjct: 176 RETTPCSLIRDPETIRTPGSTTKPASSSGINRRMDNSRQGHVPTTQEMDQFFQSAEEEQQ 235 Query: 381 RVFIERYNYDPVTDLP 428 RVF ++YN+DPV D P Sbjct: 236 RVFTDKYNFDPVNDKP 251 >emb|CAN70215.1| hypothetical protein VITISV_012042 [Vitis vinifera] Length = 252 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RE+TP + + PGSTTK D R+G+ P++ EM+ FF AE+ Q+ Sbjct: 165 RETTPCSLIRDPETIRTPGSTTKPASSSGINRRMDNSRQGHVPTTQEMDQFFQSAEEEQQ 224 Query: 381 RVFIERYNYDPVTDLP 428 RVF ++YN+DPV D P Sbjct: 225 RVFTDKYNFDPVNDKP 240 >ref|XP_002521100.1| conserved hypothetical protein [Ricinus communis] gi|223539669|gb|EEF41251.1| conserved hypothetical protein [Ricinus communis] Length = 239 Score = 63.2 bits (152), Expect = 3e-08 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 4/77 (5%) Frame = +3 Query: 210 RESTPTPVFHSFTPPGSTTKSKGRVAAAATYDLRRRGNA----PSSHEMEDFFADAEQHQ 377 RESTP + G+ + G+ ++ AT + R R N P++HEME+FF AEQ Q Sbjct: 152 RESTPCNLIKDSDATGTPCSTTGQASSTAT-NRRVRNNIQRSIPTTHEMEEFFTCAEQRQ 210 Query: 378 RRVFIERYNYDPVTDLP 428 RR+FIE+YN+D DLP Sbjct: 211 RRLFIEKYNFDVANDLP 227 >ref|XP_002301783.1| hypothetical protein POPTR_0002s24360g [Populus trichocarpa] gi|222843509|gb|EEE81056.1| hypothetical protein POPTR_0002s24360g [Populus trichocarpa] Length = 223 Score = 63.2 bits (152), Expect = 3e-08 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP + + PGSTT+ + A + L + N P++ EM++FFA EQ Q+ Sbjct: 137 RESTPCSLIRDSETIATPGSTTRQRSSTAGSQRL-LNTQRNIPTTCEMDEFFAGVEQQQQ 195 Query: 381 RVFIERYNYDPVTDLP 428 R+FIE+YN+D V DLP Sbjct: 196 RLFIEKYNFDIVNDLP 211 >gb|AEZ35251.1| cyclin-dependent kinase inhibitor [Persea americana] Length = 218 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/81 (41%), Positives = 49/81 (60%), Gaps = 8/81 (9%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNA-----PSSHEMEDFFADA 365 RE+TP+ + + PGSTT+ AT RR+ N PS+ EME+FFA A Sbjct: 133 RETTPSSLIRDPETLEAPGSTTRR-----TRATASTRRKQNTMSRIIPSAQEMEEFFASA 187 Query: 366 EQHQRRVFIERYNYDPVTDLP 428 EQ Q+ +F+E+YNY+P++D P Sbjct: 188 EQQQQMIFMEKYNYNPISDSP 208 >ref|XP_006443609.1| hypothetical protein CICLE_v10022181mg [Citrus clementina] gi|557545871|gb|ESR56849.1| hypothetical protein CICLE_v10022181mg [Citrus clementina] Length = 214 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/78 (43%), Positives = 46/78 (58%), Gaps = 3/78 (3%) Frame = +3 Query: 204 RDRESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQH 374 RDRESTP + PGS T+ G A + P+++E+E+FFA AE+ Sbjct: 125 RDRESTPCSFIRGCDTIGTPGSITRRTGSPATNQGVQNGVQRIMPTANEIEEFFATAEKQ 184 Query: 375 QRRVFIERYNYDPVTDLP 428 QRR+FIE+YN+D V DLP Sbjct: 185 QRRLFIEKYNFDIVNDLP 202 >gb|EOY05315.1| Cyclin dependent kinase inhibitor, putative [Theobroma cacao] Length = 264 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/76 (42%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP + S PGSTT+ R + P++ EM++FFA AE+ Q+ Sbjct: 177 RESTPCSLIRDPESIRTPGSTTRPTSSAETNQRVQNSTRRHIPTAQEMDEFFAVAEEEQQ 236 Query: 381 RVFIERYNYDPVTDLP 428 R FIE+YN+DPV D P Sbjct: 237 RQFIEKYNFDPVNDKP 252 >gb|EMJ00561.1| hypothetical protein PRUPE_ppa025388mg [Prunus persica] Length = 265 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVF---HSFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP ++ PGSTT+ VA + N P++ EME+FFA EQ Q+ Sbjct: 178 RESTPCSFIRESNTIGTPGSTTRRTSSVATHRRVRNDMQRNIPTTLEMEEFFAQHEQEQQ 237 Query: 381 RVFIERYNYDPVTDLP 428 R+F+E+YN+D +DLP Sbjct: 238 RIFLEKYNFDITSDLP 253 >ref|XP_006369798.1| hypothetical protein POPTR_0001s32120g [Populus trichocarpa] gi|550348684|gb|ERP66367.1| hypothetical protein POPTR_0001s32120g [Populus trichocarpa] Length = 248 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/76 (42%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTP---TPVFHSFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP T PGSTTK ++ R + P++HEM++FF AE+ Q Sbjct: 161 RESTPCNLTRGTEDARTPGSTTKPANPTESSRRLHNSTRRHIPTAHEMDEFFGPAEEEQL 220 Query: 381 RVFIERYNYDPVTDLP 428 R F E+YN+DPV+D P Sbjct: 221 RQFTEKYNFDPVSDKP 236 >ref|NP_001048905.1| Os03g0137800 [Oryza sativa Japonica Group] gi|122196589|sp|Q283L0.1|KRP5_ORYSJ RecName: Full=Cyclin-dependent kinase inhibitor 5; AltName: Full=KIP-related protein 5 gi|81251435|gb|ABB70062.1| Kip-related protein 5 [Oryza sativa Japonica Group] gi|108706076|gb|ABF93871.1| Cyclin-dependent kinase inhibitor family protein, expressed [Oryza sativa Japonica Group] gi|113547376|dbj|BAF10819.1| Os03g0137800 [Oryza sativa Japonica Group] gi|215693982|dbj|BAG89175.1| unnamed protein product [Oryza sativa Japonica Group] Length = 221 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFHS---FTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RE+TP + S + PGSTTK+ +++ + PSS EME+FFA AEQ Q Sbjct: 134 RETTPCSLIRSSEMISTPGSTTKTNTSISSRRRMETSVCRYVPSSLEMEEFFAAAEQQQH 193 Query: 381 RVFIERYNYDPVTDLP 428 + F ERYN+ PV D P Sbjct: 194 QAFRERYNFCPVNDCP 209 >gb|EAZ25508.1| hypothetical protein OsJ_09332 [Oryza sativa Japonica Group] Length = 221 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFHS---FTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RE+TP + S + PGSTTK+ +++ + PSS EME+FFA AEQ Q Sbjct: 134 RETTPCSLIRSSEMISTPGSTTKTNTSISSRRRMETSVCRYVPSSLEMEEFFAAAEQQQH 193 Query: 381 RVFIERYNYDPVTDLP 428 + F ERYN+ PV D P Sbjct: 194 QAFRERYNFCPVNDCP 209 >ref|XP_006349933.1| PREDICTED: cyclin-dependent kinase inhibitor 4-like [Solanum tuberosum] Length = 234 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/75 (41%), Positives = 46/75 (61%) Frame = +3 Query: 204 RDRESTPTPVFHSFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQRR 383 RD ++ PTP S T P + +++ GR +A + P++HEM DFFA E+ Q++ Sbjct: 156 RDPDNIPTP--GSSTRPNNASEANGREPTSAQRII------PTAHEMNDFFAGTEEKQQK 207 Query: 384 VFIERYNYDPVTDLP 428 FIE+YN+DPV D P Sbjct: 208 QFIEKYNFDPVNDKP 222 >ref|XP_002518110.1| conserved hypothetical protein [Ricinus communis] gi|223542706|gb|EEF44243.1| conserved hypothetical protein [Ricinus communis] Length = 266 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP + S PGSTT R ++ R + P++HEM++FF AE+ Q+ Sbjct: 183 RESTPCSLIRDPESIRTPGSTT----RPSSTEPNRTSMRRHIPTAHEMDEFFTGAEEEQQ 238 Query: 381 RVFIERYNYDPVTDLP 428 + FIE+YN+DPV D P Sbjct: 239 KRFIEKYNFDPVNDKP 254 >gb|EAY88461.1| hypothetical protein OsI_09928 [Oryza sativa Indica Group] Length = 233 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFHS---FTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RE+TP + S + PGSTTK+ +++ + PSS EME+FFA AEQ Q Sbjct: 146 RETTPCSLIRSSEMISTPGSTTKTNTSMSSRRRMETSVCRYVPSSLEMEEFFAAAEQQQH 205 Query: 381 RVFIERYNYDPVTDLP 428 + F ERYN+ PV D P Sbjct: 206 QAFRERYNFCPVNDCP 221 >gb|EXC16926.1| Cyclin-dependent kinase inhibitor 4 [Morus notabilis] Length = 275 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFHS---FTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP + PGSTT+ + + P++HEM++FFA AE Q+ Sbjct: 188 RESTPCSLIRDPDIIRTPGSTTRRTNSAETNRRIQNSSQRHIPTAHEMDEFFAGAEVEQQ 247 Query: 381 RVFIERYNYDPVTDLP 428 + FI++YN+DPV+D P Sbjct: 248 KQFIDKYNFDPVSDKP 263 >ref|XP_004296651.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Fragaria vesca subsp. vesca] Length = 219 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP + + PGSTT+ + + P++H+M++FFA AE+ Q+ Sbjct: 132 RESTPCSLIRDPDTIRTPGSTTRPTNSADTNRRIQNSSQRHIPTAHDMDEFFAGAEEEQQ 191 Query: 381 RVFIERYNYDPVTDLP 428 + FI++YN+DPV D P Sbjct: 192 KQFIDKYNFDPVNDKP 207 >ref|XP_004253000.1| PREDICTED: cyclin-dependent kinase inhibitor 3-like [Solanum lycopersicum] gi|306481011|emb|CBL51953.1| kip-related protein [Solanum lycopersicum var. cerasiforme] Length = 232 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFH---SFTPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RESTP + S PGS+T++ + P++HEM DFFA E+ Q+ Sbjct: 145 RESTPCNLIRDPDSIPTPGSSTRANNASEGNGREPTSAQRIIPTAHEMNDFFAGTEEKQQ 204 Query: 381 RVFIERYNYDPVTDLP 428 + FIE+YN+DPV D P Sbjct: 205 KQFIEKYNFDPVNDKP 220 >ref|XP_006395120.1| hypothetical protein EUTSA_v10004871mg [Eutrema salsugineum] gi|557091759|gb|ESQ32406.1| hypothetical protein EUTSA_v10004871mg [Eutrema salsugineum] Length = 227 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 3/76 (3%) Frame = +3 Query: 210 RESTPTPVFHSF---TPPGSTTKSKGRVAAAATYDLRRRGNAPSSHEMEDFFADAEQHQR 380 RE+TP V PGS+TKS A Y R P++ E+E+FFA AEQ Q+ Sbjct: 142 RENTPCNVVEDLEIIVTPGSSTKSMR--TATKDYTRDRDSMVPTTSELEEFFAYAEQQQQ 199 Query: 381 RVFIERYNYDPVTDLP 428 R+F+E+YN+D V D+P Sbjct: 200 RLFMEKYNFDIVHDMP 215