BLASTX nr result
ID: Ephedra27_contig00025435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025435 (361 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG45995.1| hypothetical protein 0_16347_01, partial [Pinus t... 56 6e-06 gb|AFG46000.1| hypothetical protein 0_16347_01, partial [Pinus t... 55 7e-06 gb|AEW07994.1| hypothetical protein 0_16347_01, partial [Pinus r... 55 7e-06 >gb|AFG45995.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130529|gb|AFG45996.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130531|gb|AFG45997.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130533|gb|AFG45998.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130535|gb|AFG45999.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130539|gb|AFG46001.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130541|gb|AFG46002.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130543|gb|AFG46003.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130545|gb|AFG46004.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130547|gb|AFG46005.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130549|gb|AFG46006.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130551|gb|AFG46007.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130555|gb|AFG46009.1| hypothetical protein 0_16347_01, partial [Pinus taeda] Length = 153 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = +1 Query: 85 VVAWAVATSTSRILLGRHYVFDXXXXXXXXXXXXXXXYHFLIVSPQFTEVVRGLVIGYPC 264 ++ W++ATS+SRILLGRH+V D Y+ VS +F+E + G C Sbjct: 72 IMMWSIATSSSRILLGRHFVLDVLAGAILGVLEAFIVYNLFFVSERFSEESYLWIAGNAC 131 Query: 265 SFHGYFPQFLAGLCK 309 Y P F+ LCK Sbjct: 132 RHETYLPVFVGSLCK 146 >gb|AFG46000.1| hypothetical protein 0_16347_01, partial [Pinus taeda] gi|383130553|gb|AFG46008.1| hypothetical protein 0_16347_01, partial [Pinus taeda] Length = 153 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = +1 Query: 85 VVAWAVATSTSRILLGRHYVFDXXXXXXXXXXXXXXXYHFLIVSPQFTEVVRGLVIGYPC 264 ++ W++ATS+SRILLGRH+V D Y+ VS +F+E + G C Sbjct: 72 IMMWSIATSSSRILLGRHFVLDVLAGAILGVLEAFIVYNLFFVSERFSEESYLWIAGNVC 131 Query: 265 SFHGYFPQFLAGLCK 309 Y P F+ LCK Sbjct: 132 RHETYLPVFVGSLCK 146 >gb|AEW07994.1| hypothetical protein 0_16347_01, partial [Pinus radiata] Length = 153 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/75 (36%), Positives = 37/75 (49%) Frame = +1 Query: 85 VVAWAVATSTSRILLGRHYVFDXXXXXXXXXXXXXXXYHFLIVSPQFTEVVRGLVIGYPC 264 ++ W++ATS SRILLGRH+V D Y+ VS +F+E + G C Sbjct: 72 IMMWSIATSASRILLGRHFVLDVLAGAILGVLEAFIVYNLFFVSERFSEESYLWIAGNAC 131 Query: 265 SFHGYFPQFLAGLCK 309 Y P F+ LCK Sbjct: 132 RHETYLPVFVGSLCK 146