BLASTX nr result
ID: Ephedra27_contig00025345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025345 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001453096.1| hypothetical protein [Paramecium tetraurelia... 58 1e-06 >ref|XP_001453096.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124420796|emb|CAK85699.1| unnamed protein product [Paramecium tetraurelia] Length = 2103 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/62 (41%), Positives = 34/62 (54%) Frame = +1 Query: 7 CQQKVFHTFLLCDHRLFVQCWQKTKQELKCHELCGKKLDCGHPCKLQCFKDCKTNECTVC 186 C+ V C H +QC + K+ KC E C K L+CGH C LQC DCK N+C + Sbjct: 1632 CRTMVQKQIQECGHTTSIQCSDQHKKT-KCRERCEKILNCGHQCALQCIDDCKMNKCLIQ 1690 Query: 187 IE 192 I+ Sbjct: 1691 IQ 1692