BLASTX nr result
ID: Ephedra27_contig00025292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00025292 (719 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002962278.1| hypothetical protein SELMODRAFT_76873 [Selag... 60 7e-07 ref|XP_002965192.1| hypothetical protein SELMODRAFT_83158 [Selag... 60 7e-07 ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [A... 57 8e-06 >ref|XP_002962278.1| hypothetical protein SELMODRAFT_76873 [Selaginella moellendorffii] gi|300170937|gb|EFJ37538.1| hypothetical protein SELMODRAFT_76873 [Selaginella moellendorffii] Length = 673 Score = 60.1 bits (144), Expect = 7e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 717 RPPMSEVVQALVRLMQRAGLNKRISSDEAGLSHRQYENEPSDY 589 RPPMSEVVQ+LVRLMQRA L+KR S DE G S R + PSDY Sbjct: 631 RPPMSEVVQSLVRLMQRASLSKRSSGDELGGSQRSMHDPPSDY 673 >ref|XP_002965192.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii] gi|300167425|gb|EFJ34030.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii] Length = 362 Score = 60.1 bits (144), Expect = 7e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 717 RPPMSEVVQALVRLMQRAGLNKRISSDEAGLSHRQYENEPSDY 589 RPPMSEVVQ+LVRLMQRA L+KR S DE G S R + PSDY Sbjct: 320 RPPMSEVVQSLVRLMQRASLSKRSSGDELGGSQRSMHDPPSDY 362 >ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda] gi|548847629|gb|ERN06791.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda] Length = 381 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -3 Query: 717 RPPMSEVVQALVRLMQRAGLNKRISSDEAGLSHRQYENEPSDYS 586 RPPMSEVVQALVRLMQRA +NKR SSDE+G++ + + E + S Sbjct: 337 RPPMSEVVQALVRLMQRASMNKRRSSDESGIAFKMPDYEQLEMS 380