BLASTX nr result
ID: Ephedra27_contig00024947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00024947 (1370 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523324.1| conserved hypothetical protein [Ricinus comm... 58 8e-06 >ref|XP_002523324.1| conserved hypothetical protein [Ricinus communis] gi|223537412|gb|EEF39040.1| conserved hypothetical protein [Ricinus communis] Length = 239 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = -3 Query: 813 SPPRLPILTKPLWVLQAEASGMMTPPFGSAGSVPFKWEETPGKAKPSS 670 S PRLP+ KP +V + SGM+TPP S+ +VPF+WEE PGK + S Sbjct: 11 STPRLPLFLKPPYVQSPQRSGMLTPPLYSSAAVPFRWEEEPGKPRECS 58