BLASTX nr result
ID: Ephedra27_contig00024526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00024526 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552626.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 57 2e-06 ref|XP_003633168.1| PREDICTED: probable LRR receptor-like serine... 57 3e-06 emb|CAN63294.1| hypothetical protein VITISV_040285 [Vitis vinifera] 57 3e-06 ref|XP_004507770.1| PREDICTED: probable LRR receptor-like serine... 56 6e-06 ref|XP_003549524.2| PREDICTED: probable LRR receptor-like serine... 55 1e-05 ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 55 1e-05 ref|XP_002325107.1| leucine-rich repeat family protein [Populus ... 55 1e-05 >ref|XP_003552626.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Glycine max] gi|571549687|ref|XP_006602982.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Glycine max] Length = 623 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 109 LLQNNNISGPLPKELGKLTRLQTLDLSNNQSSG 11 LLQNNNISGP+P ELGKL++LQTLDLSNN SG Sbjct: 103 LLQNNNISGPIPSELGKLSKLQTLDLSNNFFSG 135 >ref|XP_003633168.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g23950-like [Vitis vinifera] gi|297743709|emb|CBI36592.3| unnamed protein product [Vitis vinifera] Length = 640 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 109 LLQNNNISGPLPKELGKLTRLQTLDLSNNQSSGLV 5 LLQNNNISGP+P ELG L RLQTLDLSNN+ +G V Sbjct: 97 LLQNNNISGPIPTELGTLPRLQTLDLSNNRFAGAV 131 >emb|CAN63294.1| hypothetical protein VITISV_040285 [Vitis vinifera] Length = 640 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 109 LLQNNNISGPLPKELGKLTRLQTLDLSNNQSSGLV 5 LLQNNNISGP+P ELG L RLQTLDLSNN+ +G V Sbjct: 97 LLQNNNISGPIPTELGTLPRLQTLDLSNNRFAGAV 131 >ref|XP_004507770.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g30520-like [Cicer arietinum] Length = 638 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 109 LLQNNNISGPLPKELGKLTRLQTLDLSNNQSSGLV 5 LLQNNNISG +P ELGKL +LQTLDLSNN+ SG + Sbjct: 98 LLQNNNISGKIPPELGKLPKLQTLDLSNNRFSGFI 132 >ref|XP_003549524.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g23950-like [Glycine max] Length = 644 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 109 LLQNNNISGPLPKELGKLTRLQTLDLSNNQSSGLV 5 LLQNNNISG +P ELG L +LQTLDLSNN+ SGL+ Sbjct: 101 LLQNNNISGNIPPELGNLPKLQTLDLSNNRFSGLI 135 >ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max] Length = 623 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 109 LLQNNNISGPLPKELGKLTRLQTLDLSNNQSSG 11 LLQNNNISGP+P ELGKL +LQTLDLSNN G Sbjct: 103 LLQNNNISGPIPSELGKLPKLQTLDLSNNFFKG 135 >ref|XP_002325107.1| leucine-rich repeat family protein [Populus trichocarpa] gi|222866541|gb|EEF03672.1| leucine-rich repeat family protein [Populus trichocarpa] Length = 637 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 109 LLQNNNISGPLPKELGKLTRLQTLDLSNNQSSGLV 5 LLQNNNISG +P ELG L++LQTLDLSNN+ SG+V Sbjct: 98 LLQNNNISGQIPPELGTLSKLQTLDLSNNRFSGVV 132