BLASTX nr result
ID: Ephedra27_contig00024333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00024333 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002519988.1| translation initiation factor 1 (chloroplast... 154 2e-35 ref|YP_002519989.1| ribosomal protein S8 (chloroplast) [Ephedra ... 140 2e-31 ref|YP_002519750.1| translation initiation factor 1 [Gnetum parv... 120 1e-25 ref|YP_001876612.1| ribosomal protein S8 [Welwitschia mirabilis]... 112 4e-23 dbj|BAH11194.1| translation initiation factor 1 (chloroplast) [W... 108 7e-22 ref|YP_008082228.1| ribosomal protein S8 (chloroplast) [Gnetum m... 108 1e-21 ref|YP_002519573.1| ribosomal protein S8 [Keteleeria davidiana] ... 108 1e-21 ref|YP_004891444.1| ribosomal protein S8 (chloroplast) [Pseudots... 106 4e-21 dbj|BAN16901.1| ribosomal protein S8 (chloroplast) [Gnetum ula] 105 5e-21 ref|YP_003934149.1| ribosomal protein S8 [Cedrus deodara] gi|228... 105 5e-21 gb|ACP51417.1| ribosomal protein S8 [Abies firma] 105 5e-21 ref|YP_002519749.1| ribosomal protein S8 [Gnetum parvifolium] gi... 105 5e-21 ref|NP_042442.1| ribosomal protein S8 [Pinus thunbergii] gi|5127... 105 8e-21 ref|NP_817224.1| ribosomal protein S8 [Pinus koraiensis] gi|2376... 105 8e-21 gb|AET49566.1| ribosomal protein S8 (chloroplast) [Pinus cubensis] 105 8e-21 gb|AET47770.1| ribosomal protein S8 (chloroplast) [Pinus pringlei] 105 8e-21 gb|AET46764.1| ribosomal protein S8 (chloroplast) [Pinus patula]... 105 8e-21 gb|AET46620.1| ribosomal protein S8 (chloroplast) [Pinus pinea] 105 8e-21 gb|AET44763.1| ribosomal protein S8 (chloroplast) [Pinus bungeana] 105 8e-21 ref|YP_003934451.1| ribosomal protein S8 [Cathaya argyrophylla] ... 105 8e-21 >ref|YP_002519988.1| translation initiation factor 1 (chloroplast) [Ephedra equisetina] gi|220983589|dbj|BAH11356.1| translation initiation factor 1 (chloroplast) [Ephedra equisetina] Length = 77 Score = 154 bits (388), Expect = 2e-35 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = +1 Query: 256 MKMEKRQNMIELEGLVIEAHPAGFFRVLLDNKKTVLAYISGNIRQNSIRILVGDRVKIEL 435 MKMEKRQNMIELEGLVIEAHPAGFFRVLLDNKKTVLAYISGNIRQNSIRILVGDRVKIEL Sbjct: 1 MKMEKRQNMIELEGLVIEAHPAGFFRVLLDNKKTVLAYISGNIRQNSIRILVGDRVKIEL 60 Query: 436 HVCDLTKGRIIHRFRKS 486 HVCDLTKGRIIHRFRKS Sbjct: 61 HVCDLTKGRIIHRFRKS 77 >ref|YP_002519989.1| ribosomal protein S8 (chloroplast) [Ephedra equisetina] gi|220983590|dbj|BAH11357.1| ribosomal protein S8 (chloroplast) [Ephedra equisetina] Length = 128 Score = 140 bits (352), Expect = 2e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG Sbjct: 61 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 120 Query: 182 GEILCYAW 205 GEILCYAW Sbjct: 121 GEILCYAW 128 >ref|YP_002519750.1| translation initiation factor 1 [Gnetum parvifolium] gi|512721608|ref|YP_008082227.1| translation initiation factor 1 (chloroplast) [Gnetum montanum] gi|220983492|dbj|BAH11260.1| translation initiation factor 1 (chloroplast) [Gnetum parvifolium] gi|490345053|gb|AGL11073.1| translation initiation factor 1 (chloroplast) [Gnetum montanum] Length = 76 Score = 120 bits (302), Expect = 1e-25 Identities = 57/75 (76%), Positives = 69/75 (92%) Frame = +1 Query: 262 MEKRQNMIELEGLVIEAHPAGFFRVLLDNKKTVLAYISGNIRQNSIRILVGDRVKIELHV 441 MEK+ +M+E+EG+V HPAGFFRVLLDN++T+LA ISGNIRQ SIRILVGDRVK+ELH+ Sbjct: 1 MEKK-DMVEIEGIVTRTHPAGFFRVLLDNQETILASISGNIRQKSIRILVGDRVKVELHI 59 Query: 442 CDLTKGRIIHRFRKS 486 CDLT+GRIIHRFRK+ Sbjct: 60 CDLTRGRIIHRFRKA 74 >ref|YP_001876612.1| ribosomal protein S8 [Welwitschia mirabilis] gi|254809474|sp|B2Y1Z5.1|RR8_WELMI RecName: Full=30S ribosomal protein S8, chloroplastic gi|163311667|gb|ABY26825.1| ribosomal protein S8 [Welwitschia mirabilis] gi|220983424|dbj|BAH11193.1| ribosomal protein S8 (chloroplast) [Welwitschia mirabilis] Length = 128 Score = 112 bits (281), Expect = 4e-23 Identities = 53/67 (79%), Positives = 60/67 (89%) Frame = +2 Query: 5 KYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIGG 184 KYRKKKE RITLKRISKPG++IYS+F +PKVL G+GI I+STS+GIMTD EARQKKIGG Sbjct: 62 KYRKKKEKRITLKRISKPGRKIYSDFPNMPKVLGGMGIAIVSTSRGIMTDREARQKKIGG 121 Query: 185 EILCYAW 205 EILCY W Sbjct: 122 EILCYVW 128 >dbj|BAH11194.1| translation initiation factor 1 (chloroplast) [Welwitschia mirabilis] Length = 131 Score = 108 bits (270), Expect = 7e-22 Identities = 53/83 (63%), Positives = 67/83 (80%) Frame = +1 Query: 235 YIFQKRNMKMEKRQNMIELEGLVIEAHPAGFFRVLLDNKKTVLAYISGNIRQNSIRILVG 414 Y +K NM K+ ++IE+EG+V EA+PAG F+VLLDN+KTVLAYISG IRQ I ILVG Sbjct: 46 YCIKKTNMHKHKK-DVIEMEGIVTEAYPAGLFKVLLDNQKTVLAYISGKIRQKKILILVG 104 Query: 415 DRVKIELHVCDLTKGRIIHRFRK 483 DRVK+E H+ DLT+GRI +RFR+ Sbjct: 105 DRVKVEFHISDLTRGRITYRFRE 127 >ref|YP_008082228.1| ribosomal protein S8 (chloroplast) [Gnetum montanum] gi|490345054|gb|AGL11074.1| ribosomal protein S8 (chloroplast) [Gnetum montanum] Length = 128 Score = 108 bits (269), Expect = 1e-21 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +2 Query: 5 KYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIGG 184 KYRK+ E ITLKRIS+PG RIYS+F KIPKVL G+GIVILSTSQGIMTD EAR+KKIGG Sbjct: 62 KYRKRGEKIITLKRISRPGWRIYSDFPKIPKVLGGMGIVILSTSQGIMTDREARKKKIGG 121 Query: 185 EILCYAW 205 E+LC+ W Sbjct: 122 ELLCFVW 128 >ref|YP_002519573.1| ribosomal protein S8 [Keteleeria davidiana] gi|220983673|dbj|BAH11439.1| ribosomal protein S8 (chloroplast) [Keteleeria davidiana] Length = 132 Score = 108 bits (269), Expect = 1e-21 Identities = 53/69 (76%), Positives = 59/69 (85%), Gaps = 2/69 (2%) Frame = +2 Query: 5 KYRKKKETRI--TLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKI 178 KYR++KE TLKR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKI Sbjct: 64 KYRRRKERTYITTLKRTSKPGSRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKI 123 Query: 179 GGEILCYAW 205 GGEILCY W Sbjct: 124 GGEILCYVW 132 >ref|YP_004891444.1| ribosomal protein S8 (chloroplast) [Pseudotsuga sinensis var. wilsoniana] gi|307683501|dbj|BAJ19729.1| ribosomal protein S8 [Pseudotsuga sinensis var. wilsoniana] gi|347977662|dbj|BAK86617.1| ribosomal protein S8 [Pseudotsuga sinensis var. wilsoniana] gi|356998512|gb|AET46403.1| ribosomal protein S8 (chloroplast) [Pseudotsuga menziesii var. menziesii] Length = 132 Score = 106 bits (264), Expect = 4e-21 Identities = 53/66 (80%), Positives = 58/66 (87%), Gaps = 1/66 (1%) Frame = +2 Query: 11 RKKKETRITL-KRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIGGE 187 R+KK T IT KRISKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIGGE Sbjct: 67 RRKKRTYITTSKRISKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIGGE 126 Query: 188 ILCYAW 205 ILCY W Sbjct: 127 ILCYVW 132 >dbj|BAN16901.1| ribosomal protein S8 (chloroplast) [Gnetum ula] Length = 128 Score = 105 bits (263), Expect = 5e-21 Identities = 50/67 (74%), Positives = 59/67 (88%) Frame = +2 Query: 5 KYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIGG 184 KY+K+ E I LKRIS+PG+RIYS+F KIPKVL G+GIVILSTSQGIMTD EAR+KKIGG Sbjct: 62 KYQKRGEKIINLKRISRPGRRIYSDFPKIPKVLGGMGIVILSTSQGIMTDQEARKKKIGG 121 Query: 185 EILCYAW 205 E+LC+ W Sbjct: 122 ELLCFVW 128 >ref|YP_003934149.1| ribosomal protein S8 [Cedrus deodara] gi|228017095|gb|ACP51917.1| ribosomal protein S8 [Cedrus deodara] gi|307683224|dbj|BAJ19532.1| ribosomal protein S8 (chloroplast) [Cedrus deodara] Length = 132 Score = 105 bits (263), Expect = 5e-21 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 2/69 (2%) Frame = +2 Query: 5 KYRKKKETRI--TLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKI 178 KYR++KE T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKI Sbjct: 64 KYRRRKERTYITTSKRTSKPGSRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKI 123 Query: 179 GGEILCYAW 205 GGEILCY W Sbjct: 124 GGEILCYVW 132 >gb|ACP51417.1| ribosomal protein S8 [Abies firma] Length = 132 Score = 105 bits (263), Expect = 5e-21 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 2/69 (2%) Frame = +2 Query: 5 KYRKKKETRI--TLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKI 178 KYR++KE T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKI Sbjct: 64 KYRRRKERTYITTSKRTSKPGSRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKI 123 Query: 179 GGEILCYAW 205 GGEILCY W Sbjct: 124 GGEILCYVW 132 >ref|YP_002519749.1| ribosomal protein S8 [Gnetum parvifolium] gi|158706202|sp|A6BM56.1|RR8_GNEPA RecName: Full=30S ribosomal protein S8, chloroplastic gi|149941468|dbj|BAF64901.1| ribosomal protein S8 [Gnetum parvifolium] gi|220983491|dbj|BAH11259.1| ribosomal protein S8 (chloroplast) [Gnetum parvifolium] Length = 128 Score = 105 bits (263), Expect = 5e-21 Identities = 51/67 (76%), Positives = 58/67 (86%) Frame = +2 Query: 5 KYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIGG 184 KYRK+ E ITLKRIS+PG RIYS+F KIPKVL G+GIVIL TSQGIMTD EAR+KKIGG Sbjct: 62 KYRKRGEKIITLKRISRPGWRIYSDFPKIPKVLGGMGIVILFTSQGIMTDREARKKKIGG 121 Query: 185 EILCYAW 205 E+LC+ W Sbjct: 122 ELLCFVW 128 >ref|NP_042442.1| ribosomal protein S8 [Pinus thunbergii] gi|512721671|ref|YP_008082289.1| ribosomal protein S8 (chloroplast) [Pinus massoniana] gi|1173283|sp|P41634.1|RR8_PINTH RecName: Full=30S ribosomal protein S8, chloroplastic gi|1262682|dbj|BAA04399.1| ribosomal protein S8 [Pinus thunbergii] gi|228015953|gb|ACP50793.1| ribosomal protein S8 [Pinus ponderosa] gi|228016021|gb|ACP50860.1| ribosomal protein S8 [Pinus resinosa] gi|228016406|gb|ACP51239.1| ribosomal protein S8 [Pinus thunbergii] gi|228016473|gb|ACP51305.1| ribosomal protein S8 [Pinus torreyana subsp. insularis] gi|228016534|gb|ACP51365.1| ribosomal protein S8 [Pinus torreyana subsp. torreyana] gi|228016846|gb|ACP51672.1| ribosomal protein S8 [Pinus attenuata] gi|228017472|gb|ACP52288.1| ribosomal protein S8 [Pinus merkusii] gi|356996994|gb|AET44906.1| ribosomal protein S8 (chloroplast) [Pinus arizonica] gi|356997209|gb|AET45118.1| ribosomal protein S8 (chloroplast) [Pinus yecorensis] gi|356997498|gb|AET45403.1| ribosomal protein S8 (chloroplast) [Pinus tropicalis] gi|356997571|gb|AET45475.1| ribosomal protein S8 (chloroplast) [Pinus taiwanensis] gi|356997644|gb|AET45547.1| ribosomal protein S8 (chloroplast) [Pinus sylvestris] gi|356997861|gb|AET45761.1| ribosomal protein S8 (chloroplast) [Pinus sabiniana] gi|356997934|gb|AET45833.1| ribosomal protein S8 (chloroplast) [Pinus roxburghii] gi|356998153|gb|AET46049.1| ribosomal protein S8 (chloroplast) [Pinus radiata] gi|356998586|gb|AET46476.1| ribosomal protein S8 (chloroplast) [Pinus ponderosa var. scopulorum] gi|356998659|gb|AET46548.1| ribosomal protein S8 (chloroplast) [Pinus ponderosa var. benthamiana] gi|356999097|gb|AET46980.1| ribosomal protein S8 (chloroplast) [Pinus pseudostrobus var. apulcensis] gi|356999170|gb|AET47052.1| ribosomal protein S8 (chloroplast) [Pinus nigra] gi|356999243|gb|AET47124.1| ribosomal protein S8 (chloroplast) [Pinus muricata] gi|356999315|gb|AET47195.1| ribosomal protein S8 (chloroplast) [Pinus mugo] gi|356999460|gb|AET47338.1| ribosomal protein S8 (chloroplast) [Pinus montezumae] gi|356999606|gb|AET47482.1| ribosomal protein S8 (chloroplast) [Pinus massoniana] gi|356999971|gb|AET47842.1| ribosomal protein S8 (chloroplast) [Pinus latteri] gi|357000044|gb|AET47914.1| ribosomal protein S8 (chloroplast) [Pinus kesiya] gi|357000190|gb|AET48058.1| ribosomal protein S8 (chloroplast) [Pinus jeffreyi] gi|357000263|gb|AET48130.1| ribosomal protein S8 (chloroplast) [Pinus hwangshanensis] gi|357000336|gb|AET48202.1| ribosomal protein S8 (chloroplast) [Pinus heldreichii] gi|357000408|gb|AET48273.1| ribosomal protein S8 (chloroplast) [Pinus hartwegii] gi|357000481|gb|AET48345.1| ribosomal protein S8 (chloroplast) [Pinus halepensis] gi|357000699|gb|AET48560.1| ribosomal protein S8 (chloroplast) [Pinus fragilissima] gi|357000772|gb|AET48632.1| ribosomal protein S8 (chloroplast) [Pinus engelmannii] gi|357001066|gb|AET48922.1| ribosomal protein S8 (chloroplast) [Pinus douglasiana] gi|357001140|gb|AET48995.1| ribosomal protein S8 (chloroplast) [Pinus hartwegii] gi|357001286|gb|AET49139.1| ribosomal protein S8 (chloroplast) [Pinus devoniana] gi|357001359|gb|AET49211.1| ribosomal protein S8 (chloroplast) [Pinus densata] gi|357001432|gb|AET49283.1| ribosomal protein S8 (chloroplast) [Pinus densiflora] gi|357001792|gb|AET49638.1| ribosomal protein S8 (chloroplast) [Pinus coulteri] gi|357001865|gb|AET49710.1| ribosomal protein S8 (chloroplast) [Pinus arizonica var. cooperi] gi|490345133|gb|AGL11135.1| ribosomal protein S8 (chloroplast) [Pinus massoniana] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132 >ref|NP_817224.1| ribosomal protein S8 [Pinus koraiensis] gi|237688621|ref|YP_002905238.1| ribosomal protein S8 [Pinus gerardiana] gi|237688689|ref|YP_002905305.1| ribosomal protein S8 [Pinus krempfii] gi|324986388|ref|YP_004276260.1| ribosomal protein S8 [Pinus lambertiana] gi|324986459|ref|YP_004276330.1| ribosomal protein S8 [Pinus monophylla] gi|324986531|ref|YP_004276401.1| ribosomal protein S8 [Pinus nelsonii] gi|68052984|sp|Q85WZ6.1|RR8_PINKO RecName: Full=30S ribosomal protein S8, chloroplastic gi|29469744|gb|AAO74072.1| ribosomal protein S8 [Pinus koraiensis] gi|226876081|gb|ACO89337.1| ribosomal protein S8 [Pinus gerardiana] gi|226951146|gb|ACO94209.1| ribosomal protein S8 [Pinus krempfii] gi|228016090|gb|ACP50928.1| ribosomal protein S8 [Pinus rzedowskii] gi|228016145|gb|ACP50982.1| ribosomal protein S8 [Pinus sibirica] gi|228016211|gb|ACP51047.1| ribosomal protein S8 [Pinus squamata] gi|228016272|gb|ACP51107.1| ribosomal protein S8 [Pinus strobus] gi|228016650|gb|ACP51479.1| ribosomal protein S8 [Pinus albicaulis] gi|228016719|gb|ACP51547.1| ribosomal protein S8 [Pinus aristata] gi|228016783|gb|ACP51610.1| ribosomal protein S8 [Pinus armandii] gi|228016907|gb|ACP51732.1| ribosomal protein S8 [Pinus ayacahuite] gi|228017153|gb|ACP51974.1| ribosomal protein S8 [Pinus cembra] gi|228017276|gb|ACP52095.1| ribosomal protein S8 [Pinus flexilis] gi|228017341|gb|ACP52159.1| ribosomal protein S8 [Pinus lambertiana] gi|228017534|gb|ACP52349.1| ribosomal protein S8 [Pinus monticola] gi|228017597|gb|ACP52411.1| ribosomal protein S8 [Pinus parviflora var. pentaphylla] gi|228017661|gb|ACP52474.1| ribosomal protein S8 [Pinus peuce] gi|323514237|gb|ADX89784.1| ribosomal protein S8 [Pinus lambertiana] gi|323522554|gb|ADX94896.1| ribosomal protein S8 [Pinus monophylla] gi|323522719|gb|ADX94967.1| ribosomal protein S8 [Pinus nelsonii] gi|356996630|gb|AET44547.1| ribosomal protein S8 (chloroplast) [Pinus chiapensis] gi|356996704|gb|AET44620.1| ribosomal protein S8 (chloroplast) [Pinus cembroides] gi|356997066|gb|AET44977.1| ribosomal protein S8 (chloroplast) [Pinus amamiana] gi|356997281|gb|AET45189.1| ribosomal protein S8 (chloroplast) [Pinus kwangtungensis] gi|356997353|gb|AET45260.1| ribosomal protein S8 (chloroplast) [Pinus wallichiana] gi|356997716|gb|AET45618.1| ribosomal protein S8 (chloroplast) [Pinus strobiformis] gi|356998080|gb|AET45977.1| ribosomal protein S8 (chloroplast) [Pinus remota] gi|356998226|gb|AET46121.1| ribosomal protein S8 (chloroplast) [Pinus quadrifolia] gi|356998371|gb|AET46264.1| ribosomal protein S8 (chloroplast) [Pinus pumila] gi|356998805|gb|AET46692.1| ribosomal protein S8 (chloroplast) [Pinus pinceana] gi|356999387|gb|AET47266.1| ribosomal protein S8 (chloroplast) [Pinus morrisonicola] gi|356999533|gb|AET47410.1| ribosomal protein S8 (chloroplast) [Pinus maximartinezii] gi|357000117|gb|AET47986.1| ribosomal protein S8 (chloroplast) [Pinus johannis] gi|357000918|gb|AET48776.1| ribosomal protein S8 (chloroplast) [Pinus edulis] gi|357001213|gb|AET49067.1| ribosomal protein S8 (chloroplast) [Pinus discolor] gi|357001504|gb|AET49354.1| ribosomal protein S8 (chloroplast) [Pinus dalatensis] gi|357001646|gb|AET49494.1| ribosomal protein S8 (chloroplast) [Pinus culminicola] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132 >gb|AET49566.1| ribosomal protein S8 (chloroplast) [Pinus cubensis] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132 >gb|AET47770.1| ribosomal protein S8 (chloroplast) [Pinus pringlei] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132 >gb|AET46764.1| ribosomal protein S8 (chloroplast) [Pinus patula] gi|356999679|gb|AET47554.1| ribosomal protein S8 (chloroplast) [Pinus lumholtzii] gi|356999752|gb|AET47626.1| ribosomal protein S8 (chloroplast) [Pinus leiophylla] gi|356999825|gb|AET47698.1| ribosomal protein S8 (chloroplast) [Pinus lawsonii] gi|357000553|gb|AET48416.1| ribosomal protein S8 (chloroplast) [Pinus greggii] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132 >gb|AET46620.1| ribosomal protein S8 (chloroplast) [Pinus pinea] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132 >gb|AET44763.1| ribosomal protein S8 (chloroplast) [Pinus bungeana] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132 >ref|YP_003934451.1| ribosomal protein S8 [Cathaya argyrophylla] gi|307683297|dbj|BAJ19604.1| ribosomal protein S8 (chloroplast) [Cathaya argyrophylla] Length = 132 Score = 105 bits (261), Expect = 8e-21 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +2 Query: 2 FKYRKKKETRITLKRISKPGQRIYSNFRKIPKVLNGIGIVILSTSQGIMTDHEARQKKIG 181 ++ RKK+ T KR SKPG RIYSN+R+IPKVL G+GIVILSTSQGI+TD EARQKKIG Sbjct: 65 YRRRKKRTYMTTSKRTSKPGLRIYSNYREIPKVLGGMGIVILSTSQGILTDREARQKKIG 124 Query: 182 GEILCYAW 205 GEILCY W Sbjct: 125 GEILCYVW 132