BLASTX nr result
ID: Ephedra27_contig00023999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00023999 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70240.1| hypothetical protein M569_04520 [Genlisea aurea] 57 3e-06 ref|XP_002962128.1| hypothetical protein SELMODRAFT_77410 [Selag... 55 7e-06 ref|XP_002965031.1| hypothetical protein SELMODRAFT_82661 [Selag... 55 7e-06 >gb|EPS70240.1| hypothetical protein M569_04520 [Genlisea aurea] Length = 200 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 381 IFVIPVADVIRVRTGERGPRAERMIGGRAEMF 286 IF+IPV+DVIR+RTGERG +AERM+GGRA+MF Sbjct: 162 IFLIPVSDVIRIRTGERGEKAERMMGGRADMF 193 >ref|XP_002962128.1| hypothetical protein SELMODRAFT_77410 [Selaginella moellendorffii] gi|300170787|gb|EFJ37388.1| hypothetical protein SELMODRAFT_77410 [Selaginella moellendorffii] Length = 104 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 381 IFVIPVADVIRVRTGERGPRAERMIGGRAEM 289 IFVIPVADVIRVRTGERG +AERM+GGRA++ Sbjct: 69 IFVIPVADVIRVRTGERGLQAERMVGGRADI 99 >ref|XP_002965031.1| hypothetical protein SELMODRAFT_82661 [Selaginella moellendorffii] gi|300167264|gb|EFJ33869.1| hypothetical protein SELMODRAFT_82661 [Selaginella moellendorffii] Length = 104 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 381 IFVIPVADVIRVRTGERGPRAERMIGGRAEM 289 IFVIPVADVIRVRTGERG +AERM+GGRA++ Sbjct: 69 IFVIPVADVIRVRTGERGLQAERMVGGRADI 99