BLASTX nr result
ID: Ephedra27_contig00023848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00023848 (975 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827996.1| hypothetical protein AMTR_s00008p00236930 [A... 54 2e-06 ref|XP_004163048.1| PREDICTED: DUF246 domain-containing protein ... 46 9e-06 ref|XP_004148653.1| PREDICTED: DUF246 domain-containing protein ... 46 9e-06 >ref|XP_006827996.1| hypothetical protein AMTR_s00008p00236930 [Amborella trichopoda] gi|548832631|gb|ERM95412.1| hypothetical protein AMTR_s00008p00236930 [Amborella trichopoda] Length = 539 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 681 LVFDVKVVKEFRKELSSFPKAVKHFRSWSGIEYYLQ*VVPL 803 L DV VVK+ KEL++ KAVKHFRSWSG+EYY + PL Sbjct: 187 LASDVTVVKKLPKELTTTTKAVKHFRSWSGVEYYRNEIFPL 227 Score = 25.4 bits (54), Expect(2) = 2e-06 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 782 SSIGCSLKNLHCRVHYDALHFAPYIK 859 +++ ++ L CR Y+AL F+P I+ Sbjct: 246 NNLPLDIQKLRCRAFYNALRFSPRIE 271 >ref|XP_004163048.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 505 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +3 Query: 690 DVKVVKEFRKELSSFPKAVKHFRSWSGIEYY 782 DVK+VKE KEL S P A KHF SW+G YY Sbjct: 168 DVKIVKELPKELESIPHARKHFTSWAGFGYY 198 Score = 31.2 bits (69), Expect(2) = 9e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 800 LKNLHCRVHYDALHFAPYIKN 862 ++ L CR Y+ALHFAP I+N Sbjct: 229 IQRLRCRAMYEALHFAPPIEN 249 >ref|XP_004148653.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 505 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +3 Query: 690 DVKVVKEFRKELSSFPKAVKHFRSWSGIEYY 782 DVK+VKE KEL S P A KHF SW+G YY Sbjct: 168 DVKIVKELPKELESIPHARKHFTSWAGFGYY 198 Score = 31.2 bits (69), Expect(2) = 9e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 800 LKNLHCRVHYDALHFAPYIKN 862 ++ L CR Y+ALHFAP I+N Sbjct: 229 IQRLRCRAMYEALHFAPPIEN 249