BLASTX nr result
ID: Ephedra27_contig00023282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00023282 (382 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELA47938.1| hypothetical protein VCUG_00521, partial [Vavraia... 56 4e-06 >gb|ELA47938.1| hypothetical protein VCUG_00521, partial [Vavraia culicis subsp. floridensis] Length = 129 Score = 56.2 bits (134), Expect = 4e-06 Identities = 41/115 (35%), Positives = 60/115 (52%) Frame = +3 Query: 33 FQIL**TLADH*NLHFQILY*TLAYHLNLHFQIQN*SLAYHSNLYFQTL**TLAYCLSPH 212 F +L TL L+F +LY TL Y L+F + +L Y + LYF L TL Y + Sbjct: 1 FNLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLY 60 Query: 213 SGMQY*NLAYHLNLHIQMLQGTLAHQSNLHFRILNWTLACYQ*LHFGILY*TLAY 377 + Y L Y L+ +L TL + + L+F +L +TL + L+F +LY TL Y Sbjct: 61 FTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLYFTLLY 115