BLASTX nr result
ID: Ephedra27_contig00023261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00023261 (614 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499605.1| PREDICTED: DPH4 homolog [Cicer arietinum] 57 4e-06 >ref|XP_004499605.1| PREDICTED: DPH4 homolog [Cicer arietinum] Length = 179 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/71 (39%), Positives = 40/71 (56%) Frame = -2 Query: 214 KNHYEALCVGEKAPYSEIRANYKNALIALHPDKVMSSFSNVEESQNVYAKVVSEYQDGEM 35 + HYE L V E A Y EIRA+Y++A ++LHPDK++ +F +Q Sbjct: 10 ETHYEVLNVKEDADYEEIRASYRSAALSLHPDKLLKTFDTTSSNQTT------------- 56 Query: 34 LERFQRVQKAW 2 +RF +VQKAW Sbjct: 57 TDRFLKVQKAW 67