BLASTX nr result
ID: Ephedra27_contig00023189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00023189 (763 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532735.1| hypothetical protein RCOM_1749890 [Ricinus c... 57 9e-06 >ref|XP_002532735.1| hypothetical protein RCOM_1749890 [Ricinus communis] gi|223527512|gb|EEF29637.1| hypothetical protein RCOM_1749890 [Ricinus communis] Length = 424 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/76 (34%), Positives = 46/76 (60%) Frame = +3 Query: 480 ILWEMVYILRFLCKEPVYLAYVVFFSPKIFKILCFMWPLLASTFLMILVVFTLSPHFERL 659 +L +++ F+ P+Y Y +FFSP +F+ L F+ PL +TFL++LV T+SP+ Sbjct: 20 LLSDLLLFCSFILSHPLYFFYFIFFSPYLFRFLSFLSPLFITTFLLLLVFLTVSPNL--- 76 Query: 660 KVVEEFMDEISQEEIS 707 V + E+S+ ++S Sbjct: 77 -VHDNLSTELSESKVS 91