BLASTX nr result
ID: Ephedra27_contig00022987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00022987 (997 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857169.1| hypothetical protein AMTR_s00065p00171490 [A... 68 5e-09 ref|XP_003883267.1| hypothetical protein NCLIV_030220 [Neospora ... 59 3e-06 >ref|XP_006857169.1| hypothetical protein AMTR_s00065p00171490 [Amborella trichopoda] gi|548861252|gb|ERN18636.1| hypothetical protein AMTR_s00065p00171490 [Amborella trichopoda] Length = 1406 Score = 68.2 bits (165), Expect = 5e-09 Identities = 42/135 (31%), Positives = 72/135 (53%), Gaps = 4/135 (2%) Frame = +1 Query: 19 HRRRSKERMDKYRERDEYARPWQGKVEEARVFREKGEDSKRKD---VLGKEDAGQXXXXX 189 H R E D+ +ER+ W + E+ R REK ED +R+D +G + G+ Sbjct: 849 HFIRKNEGFDRLKERENGMGSWPWREEDTRGRREKDEDLRRRDRVEEMGSKHRGK--GHE 906 Query: 190 XXXXXXXXXXNLRKRRDQDDSRAHNNKEDIKRKEKDD-TVARPEKVDDAYSKRKRDEDLA 366 +LRKR D D RAH++KE +++E DD ++ R + +DD KR++DE++ Sbjct: 907 ASRSEKDELNHLRKRADDFDWRAHHDKEVSRQREGDDFSLVRHDALDDPRVKRRKDEEVQ 966 Query: 367 WKDKATKEESFREIR 411 +++ KE++ +R Sbjct: 967 RRERDDKEDNIYRVR 981 >ref|XP_003883267.1| hypothetical protein NCLIV_030220 [Neospora caninum Liverpool] gi|325117684|emb|CBZ53235.1| hypothetical protein NCLIV_030220 [Neospora caninum Liverpool] Length = 297 Score = 58.9 bits (141), Expect = 3e-06 Identities = 52/277 (18%), Positives = 106/277 (38%) Frame = +1 Query: 4 DKEELHRRRSKERMDKYRERDEYARPWQGKVEEARVFREKGEDSKRKDVLGKEDAGQXXX 183 D+EE +E + E+DE + + K EE + EK E+ K ++ +E+ + Sbjct: 43 DEEEEEEEEEEEEEKEEEEKDEEEKDEEEKEEEEKDEEEKDEEEKDEEEKDEEEKDEEEK 102 Query: 184 XXXXXXXXXXXXNLRKRRDQDDSRAHNNKEDIKRKEKDDTVARPEKVDDAYSKRKRDEDL 363 + +D+++ E+ K +E+ D E+ ++ K + ++D Sbjct: 103 EEEEKG--------EEEKDEEEKDEEEKDEEEKEEEEKDEEEEEEEEEEEEEKEEEEKDE 154 Query: 364 AWKDKATKEESFREIRGRDEAANXXXXXXXXXXXXXXXXXXXXXXQNSRDPKEREETGKE 543 KD+ KEE ++ +DE + +D +E++E KE Sbjct: 155 EEKDEEEKEEEEKDEEEKDEEEK----------------DEEEKEEEEKDEEEKDEEEKE 198 Query: 544 RSERDDGYQXXXXXXXXXXXXXQGIRDPRDREEMQKERQXXXXXXXXXXXXXXXXXXXXX 723 E+D+ + + +D +++E +KE + Sbjct: 199 EEEKDE--EEKDEEEKEEEEKDEEEKDEEEKDEEEKEEEEKDEEEKDEEEKEEEEKEEEE 256 Query: 724 XXXTASDMREKDDIIREKPDKGDDYHLKRKEEELKRR 834 D EK++ +E+ +KG++ K+EE K R Sbjct: 257 KGEEEKDEEEKEEEEKEEEEKGEE----EKDEEEKER 289