BLASTX nr result
ID: Ephedra27_contig00022784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00022784 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001771126.1| predicted protein [Physcomitrella patens] gi... 69 7e-10 ref|XP_001784414.1| predicted protein [Physcomitrella patens] gi... 68 1e-09 ref|XP_001751533.1| predicted protein [Physcomitrella patens] gi... 67 3e-09 ref|XP_004507276.1| PREDICTED: protein furry homolog-like [Cicer... 65 1e-08 gb|EMJ18335.1| hypothetical protein PRUPE_ppa000048mg [Prunus pe... 64 2e-08 gb|EOY00498.1| ARM repeat superfamily protein [Theobroma cacao] 63 5e-08 ref|XP_004156223.1| PREDICTED: protein furry homolog-like [Cucum... 63 5e-08 ref|XP_004141598.1| PREDICTED: protein furry homolog-like [Cucum... 63 5e-08 gb|ADN34277.1| hypothetical protein [Cucumis melo subsp. melo] 63 5e-08 ref|XP_004304179.1| PREDICTED: protein furry homolog-like [Fraga... 62 6e-08 ref|XP_002965492.1| hypothetical protein SELMODRAFT_84835 [Selag... 59 2e-07 ref|XP_002982967.1| hypothetical protein SELMODRAFT_117643 [Sela... 59 2e-07 ref|XP_006603939.1| PREDICTED: protein furry-like isoform X2 [Gl... 61 2e-07 ref|XP_006603938.1| PREDICTED: protein furry-like isoform X1 [Gl... 61 2e-07 ref|XP_006590669.1| PREDICTED: protein furry-like [Glycine max] 61 2e-07 gb|ESW23418.1| hypothetical protein PHAVU_004G045000g [Phaseolus... 60 3e-07 gb|ESW23417.1| hypothetical protein PHAVU_004G045000g [Phaseolus... 60 3e-07 ref|XP_002534056.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 ref|XP_006373529.1| hypothetical protein POPTR_0017s14560g [Popu... 60 4e-07 ref|XP_002329242.1| predicted protein [Populus trichocarpa] 60 4e-07 >ref|XP_001771126.1| predicted protein [Physcomitrella patens] gi|162677659|gb|EDQ64127.1| predicted protein [Physcomitrella patens] Length = 2226 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPIL 279 SHASAIE L RITL SCD IFG+SET LL HIVGLLP C+QL+K+ +L Sbjct: 1909 SHASAIEVLSRITLHSCDQIFGNSETRLLMHIVGLLPWLCLQLRKESTEVL 1959 >ref|XP_001784414.1| predicted protein [Physcomitrella patens] gi|162664031|gb|EDQ50766.1| predicted protein [Physcomitrella patens] Length = 2132 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKD 291 SHASAIE L RITL SCD IFG+SET LL HIVGLLP C+QL+K++ Sbjct: 1840 SHASAIEVLSRITLHSCDQIFGNSETRLLMHIVGLLPWLCLQLRKEE 1886 >ref|XP_001751533.1| predicted protein [Physcomitrella patens] gi|162697514|gb|EDQ83850.1| predicted protein [Physcomitrella patens] Length = 2125 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKD 291 SHASAIE L RITL SCD IFG+SET LL H+VGLLP C+QL K++ Sbjct: 1836 SHASAIEVLSRITLHSCDQIFGNSETRLLMHVVGLLPWLCLQLYKEE 1882 >ref|XP_004507276.1| PREDICTED: protein furry homolog-like [Cicer arietinum] Length = 2094 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH+ +I+ L RIT+ SCD IFGD+ET LL HI+GLLP C+QL K DP++G Sbjct: 1806 SHSVSIDVLSRITVHSCDSIFGDAETRLLMHIIGLLPWLCLQLSK--DPVIG 1855 >gb|EMJ18335.1| hypothetical protein PRUPE_ppa000048mg [Prunus persica] Length = 2152 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH +IE L RIT+ SCD IFGD+ET LL HI GLLP C+QL K DP++G Sbjct: 1862 SHGVSIEVLSRITVHSCDSIFGDAETRLLMHITGLLPWLCLQLSK--DPVMG 1911 >gb|EOY00498.1| ARM repeat superfamily protein [Theobroma cacao] Length = 2150 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH AIE L RIT+ SCD IFGD ET LL HI GLLP C+QL K DP++G Sbjct: 1862 SHGVAIEVLSRITVHSCDSIFGDCETRLLMHITGLLPWLCLQLCK--DPLVG 1911 >ref|XP_004156223.1| PREDICTED: protein furry homolog-like [Cucumis sativus] Length = 1397 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH +IE L RIT+ SCD IFGD+ET LL HI GLLP C+QL K DP+ G Sbjct: 1107 SHGVSIEVLSRITVHSCDSIFGDAETRLLMHITGLLPWLCLQLSK--DPLTG 1156 >ref|XP_004141598.1| PREDICTED: protein furry homolog-like [Cucumis sativus] Length = 2159 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH +IE L RIT+ SCD IFGD+ET LL HI GLLP C+QL K DP+ G Sbjct: 1869 SHGVSIEVLSRITVHSCDSIFGDAETRLLMHITGLLPWLCLQLSK--DPLTG 1918 >gb|ADN34277.1| hypothetical protein [Cucumis melo subsp. melo] Length = 2156 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH +IE L RIT+ SCD IFGD+ET LL HI GLLP C+QL K DP+ G Sbjct: 1866 SHGVSIEVLSRITVHSCDSIFGDAETRLLMHITGLLPWLCLQLSK--DPLTG 1915 >ref|XP_004304179.1| PREDICTED: protein furry homolog-like [Fragaria vesca subsp. vesca] Length = 2150 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH +IE L RIT+ SCD IFG++ET LL HI GLLP C+QL K DP++G Sbjct: 1863 SHGVSIEVLSRITVHSCDSIFGNAETRLLMHITGLLPWLCLQLSK--DPVMG 1912 >ref|XP_002965492.1| hypothetical protein SELMODRAFT_84835 [Selaginella moellendorffii] gi|300166306|gb|EFJ32912.1| hypothetical protein SELMODRAFT_84835 [Selaginella moellendorffii] Length = 2137 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 32/52 (61%), Positives = 35/52 (67%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH AIE L RITL SCD IFGDS+T LL HIVGLLP +QL K + G Sbjct: 1829 SHTCAIEVLSRITLHSCDRIFGDSDTRLLMHIVGLLPWLLLQLVKGQSHLPG 1880 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 277 GFDSPL*Q*YEKELDEMNNMSR 212 GFDSPL Q ++K N+++ Sbjct: 1880 GFDSPLQQQFQKACSVATNIAQ 1901 >ref|XP_002982967.1| hypothetical protein SELMODRAFT_117643 [Selaginella moellendorffii] gi|300149120|gb|EFJ15776.1| hypothetical protein SELMODRAFT_117643 [Selaginella moellendorffii] Length = 2137 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 32/52 (61%), Positives = 35/52 (67%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH AIE L RITL SCD IFGDS+T LL HIVGLLP +QL K + G Sbjct: 1829 SHTCAIEVLSRITLHSCDRIFGDSDTRLLMHIVGLLPWLLLQLVKGQSHLPG 1880 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 277 GFDSPL*Q*YEKELDEMNNMSR 212 GFDSPL Q ++K N+++ Sbjct: 1880 GFDSPLQQQFQKACSVATNIAQ 1901 >ref|XP_006603939.1| PREDICTED: protein furry-like isoform X2 [Glycine max] Length = 2130 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH+ +I+ L RIT+ SCD IFGD+ET LL HI+GLLP C+QL K D ++G Sbjct: 1840 SHSVSIDVLSRITVHSCDSIFGDAETRLLMHIIGLLPWLCLQLSK--DIVIG 1889 >ref|XP_006603938.1| PREDICTED: protein furry-like isoform X1 [Glycine max] Length = 2140 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH+ +I+ L RIT+ SCD IFGD+ET LL HI+GLLP C+QL K D ++G Sbjct: 1850 SHSVSIDVLSRITVHSCDSIFGDAETRLLMHIIGLLPWLCLQLSK--DIVIG 1899 >ref|XP_006590669.1| PREDICTED: protein furry-like [Glycine max] Length = 2130 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH+ +I+ L RIT+ SCD IFGD+ET LL HI+GLLP C+QL K D ++G Sbjct: 1840 SHSVSIDVLSRITVHSCDSIFGDAETRLLMHIIGLLPWLCLQLSK--DIVIG 1889 >gb|ESW23418.1| hypothetical protein PHAVU_004G045000g [Phaseolus vulgaris] Length = 1957 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH+ AI+ L R T+ SCD IFGD+ET LL HI+GLLP C+QL K D ++G Sbjct: 1667 SHSVAIDVLSRTTVHSCDSIFGDAETRLLMHIIGLLPWLCLQLSK--DIVIG 1716 >gb|ESW23417.1| hypothetical protein PHAVU_004G045000g [Phaseolus vulgaris] Length = 2129 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQKKDDPILG 276 SH+ AI+ L R T+ SCD IFGD+ET LL HI+GLLP C+QL K D ++G Sbjct: 1839 SHSVAIDVLSRTTVHSCDSIFGDAETRLLMHIIGLLPWLCLQLSK--DIVIG 1888 >ref|XP_002534056.1| conserved hypothetical protein [Ricinus communis] gi|223525919|gb|EEF28327.1| conserved hypothetical protein [Ricinus communis] Length = 1665 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQK 297 SH +IE L RIT+ SCD IFGD+ET LL HI GLLP C+QL K Sbjct: 1378 SHGVSIEVLSRITVHSCDSIFGDAETRLLMHITGLLPWLCLQLSK 1422 >ref|XP_006373529.1| hypothetical protein POPTR_0017s14560g [Populus trichocarpa] gi|550320351|gb|ERP51326.1| hypothetical protein POPTR_0017s14560g [Populus trichocarpa] Length = 2140 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQK 297 SH +IE L RIT+ SCD IFGD ET LL HI GLLP C+QL K Sbjct: 1853 SHGVSIEVLSRITVHSCDSIFGDGETRLLMHITGLLPWLCLQLSK 1897 >ref|XP_002329242.1| predicted protein [Populus trichocarpa] Length = 2158 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -3 Query: 431 SHASAIEGLFRITLQSCDCIFGDSETILLTHIVGLLPRFCMQLQK 297 SH +IE L RIT+ SCD IFGD ET LL HI GLLP C+QL K Sbjct: 1872 SHGVSIEVLSRITVHSCDSIFGDGETRLLMHITGLLPWLCLQLSK 1916