BLASTX nr result
ID: Ephedra27_contig00020928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00020928 (554 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis] 57 2e-06 >gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis] Length = 925 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 370 YQG*IGIVVPGCYGLPQFRMRAFLWGACSSELL 272 YQ +G++V GCYGLPQFRMR FLWGAC +E+L Sbjct: 606 YQARLGMMVAGCYGLPQFRMRVFLWGACPTEIL 638