BLASTX nr result
ID: Ephedra27_contig00020689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00020689 (887 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG43916.1| hypothetical protein UMN_3920_01, partial [Pinus ... 39 9e-06 >gb|AFG43916.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126594|gb|AFG43918.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126595|gb|AFG43919.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126597|gb|AFG43921.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126598|gb|AFG43922.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126599|gb|AFG43923.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126600|gb|AFG43924.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126601|gb|AFG43925.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126602|gb|AFG43926.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126603|gb|AFG43927.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126604|gb|AFG43928.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126605|gb|AFG43929.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] gi|383126607|gb|AFG43931.1| hypothetical protein UMN_3920_01, partial [Pinus taeda] Length = 143 Score = 38.9 bits (89), Expect(2) = 9e-06 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 699 NGLLCHPKLNST-WPMSVSAMNNLQ*ARTQYPNATRLKISTWVIMNMLTNSY 851 N LL HP++N WP+ + AM NLQ A + ++K+ST + M+ L SY Sbjct: 92 NELLSHPEINQPRWPLLLPAMQNLQEALQAAGLSHQIKVSTCIAMDALNVSY 143 Score = 38.1 bits (87), Expect(2) = 9e-06 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = +2 Query: 491 RSMGFFQVKIFDFNPAVLTTLSRTRXXXXXXATNK*VET 607 +SMGF QVKIFD +P +L L+ T ATN+ +ET Sbjct: 22 KSMGFGQVKIFDSDPNILNALANTSLRVVMAATNEELET 60