BLASTX nr result
ID: Ephedra27_contig00020562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00020562 (476 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ07845.1| hypothetical protein PRUPE_ppa021394mg, partial [... 55 1e-05 >gb|EMJ07845.1| hypothetical protein PRUPE_ppa021394mg, partial [Prunus persica] Length = 497 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = -3 Query: 456 VSTKKLDWNAENIVRVQTSAITGKGLEELLCLIDEKVKPIAEDTAKPRDIFNTKWRPPQN 277 ++ K+L+ ++ V+TSA+ G GL+ELL LIDEK+K + RD F+ KWRPP+ Sbjct: 429 ITEKQLELQVQSGPHVRTSALMGVGLQELLELIDEKLKEAPKANVVERDPFDRKWRPPRT 488 Query: 276 PE 271 E Sbjct: 489 EE 490