BLASTX nr result
ID: Ephedra27_contig00020341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00020341 (461 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW09021.1| hypothetical protein CL3206Contig1_01, partial [P... 57 3e-06 ref|XP_006339298.1| PREDICTED: peroxidase 21-like [Solanum tuber... 56 4e-06 ref|XP_004249496.1| PREDICTED: peroxidase 21-like [Solanum lycop... 56 4e-06 >gb|AEW09021.1| hypothetical protein CL3206Contig1_01, partial [Pinus radiata] gi|383156542|gb|AFG60537.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156544|gb|AFG60538.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156546|gb|AFG60539.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156548|gb|AFG60540.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156550|gb|AFG60541.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156552|gb|AFG60542.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156554|gb|AFG60543.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156556|gb|AFG60544.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156558|gb|AFG60545.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156560|gb|AFG60546.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156562|gb|AFG60547.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156564|gb|AFG60548.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156566|gb|AFG60549.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156568|gb|AFG60550.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156570|gb|AFG60551.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156572|gb|AFG60552.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] gi|383156574|gb|AFG60553.1| hypothetical protein CL3206Contig1_01, partial [Pinus taeda] Length = 78 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 459 KEQVNALYHEHGNTAVSWLRLIFHDCIVD 373 +EQV+ LYHEHGNTAVSWLR IFHDC+V+ Sbjct: 44 REQVDKLYHEHGNTAVSWLRTIFHDCMVE 72 >ref|XP_006339298.1| PREDICTED: peroxidase 21-like [Solanum tuberosum] Length = 329 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 459 KEQVNALYHEHGNTAVSWLRLIFHDCIVDVSIVTIL 352 KEQVN LYH+HGNTAVSW+R +FHDC+V +IL Sbjct: 49 KEQVNKLYHKHGNTAVSWIRNLFHDCMVKSCDASIL 84 >ref|XP_004249496.1| PREDICTED: peroxidase 21-like [Solanum lycopersicum] Length = 329 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 459 KEQVNALYHEHGNTAVSWLRLIFHDCIVDVSIVTIL 352 KEQVN LYH+HGNTAVSW+R +FHDC+V +IL Sbjct: 49 KEQVNKLYHKHGNTAVSWIRNLFHDCMVKSCDASIL 84