BLASTX nr result
ID: Ephedra27_contig00020068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00020068 (521 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW13991.1| hypothetical protein PHAVU_008G243900g [Phaseolus... 56 6e-06 >gb|ESW13991.1| hypothetical protein PHAVU_008G243900g [Phaseolus vulgaris] Length = 309 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/62 (48%), Positives = 38/62 (61%) Frame = -2 Query: 187 IMVFRLFVFCVLLRMSFAQLDPSLSGSQKNLDSTLQKNAFTALDRPRTGTIYPVQVPSNL 8 + V L F + + +S AQL P + S ++LD LQ AF AL RPRTG Y QVP+NL Sbjct: 7 LFVLLLLTFLLCVSLSSAQLPPDVVVSARSLDVHLQDLAFKALFRPRTGVSYDAQVPTNL 66 Query: 7 TG 2 TG Sbjct: 67 TG 68