BLASTX nr result
ID: Ephedra27_contig00019813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00019813 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADM74955.1| auxin efflux carrier-like protein, partial [Picea... 74 3e-13 gb|ADM74953.1| auxin efflux carrier-like protein, partial [Picea... 74 4e-13 gb|ADM74913.1| auxin efflux carrier-like protein, partial [Picea... 74 6e-13 gb|ADM74954.1| auxin efflux carrier-like protein, partial [Picea... 73 6e-13 ref|XP_006398552.1| hypothetical protein EUTSA_v10013614mg [Eutr... 74 1e-12 ref|XP_003623663.1| Auxin efflux carrier component auxin transpo... 74 1e-12 ref|NP_195819.1| auxin efflux carrier family protein [Arabidopsi... 74 2e-12 gb|ADM74933.1| auxin efflux carrier-like protein, partial [Picea... 72 2e-12 ref|XP_002870888.1| auxin efflux carrier family protein [Arabido... 73 2e-12 ref|NP_001242551.1| uncharacterized protein LOC100819622 [Glycin... 72 4e-12 ref|XP_006300110.1| hypothetical protein CARUB_v10016338mg [Caps... 72 6e-12 gb|AFK37905.1| unknown [Lotus japonicus] 72 6e-12 gb|ESW12027.1| hypothetical protein PHAVU_008G078600g [Phaseolus... 72 6e-12 gb|ESW12026.1| hypothetical protein PHAVU_008G078600g [Phaseolus... 72 6e-12 ref|XP_004492601.1| PREDICTED: uncharacterized transporter YBR28... 71 1e-11 ref|XP_003533648.1| PREDICTED: uncharacterized transporter YBR28... 71 1e-11 ref|XP_002326270.1| predicted protein [Populus trichocarpa] gi|5... 71 1e-11 gb|EMJ08673.1| hypothetical protein PRUPE_ppa006242mg [Prunus pe... 70 1e-11 ref|XP_004142666.1| PREDICTED: uncharacterized transporter YBR28... 70 1e-11 ref|XP_006362331.1| PREDICTED: uncharacterized transporter YBR28... 70 2e-11 >gb|ADM74955.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 219 Score = 74.3 bits (181), Expect(2) = 3e-13 Identities = 38/49 (77%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TTV+III RL LVP VGLGIV LADKLGF+ DDKMF FILLLQHT Sbjct: 123 GLRTTVAIIIARLLLVPPVGLGIVTLADKLGFIPADDKMFRFILLLQHT 171 Score = 26.2 bits (56), Expect(2) = 3e-13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 263 LYSAAMNLCILLSLGGNLFG 322 + AM CI+L+LGGNL G Sbjct: 96 ILGGAMVPCIMLALGGNLIG 115 >gb|ADM74953.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 219 Score = 73.9 bits (180), Expect(2) = 4e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TTV+III RL LVP VGLGIV LADKLGF+ DDKMF F+LLLQHT Sbjct: 123 GLRTTVAIIIARLLLVPPVGLGIVTLADKLGFIPADDKMFRFVLLLQHT 171 Score = 26.2 bits (56), Expect(2) = 4e-13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 263 LYSAAMNLCILLSLGGNLFG 322 + AM CI+L+LGGNL G Sbjct: 96 ILGGAMVPCIMLALGGNLIG 115 >gb|ADM74913.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011721|gb|ADM74914.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011723|gb|ADM74915.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011725|gb|ADM74916.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011727|gb|ADM74917.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011729|gb|ADM74918.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011731|gb|ADM74919.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011733|gb|ADM74920.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011735|gb|ADM74921.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011737|gb|ADM74922.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011739|gb|ADM74923.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011741|gb|ADM74924.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011743|gb|ADM74925.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011745|gb|ADM74926.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011747|gb|ADM74927.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011749|gb|ADM74928.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011751|gb|ADM74929.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011753|gb|ADM74930.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011755|gb|ADM74931.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011757|gb|ADM74932.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011761|gb|ADM74934.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011763|gb|ADM74935.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011765|gb|ADM74936.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011767|gb|ADM74937.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011769|gb|ADM74938.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011771|gb|ADM74939.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011773|gb|ADM74940.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011775|gb|ADM74941.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011777|gb|ADM74942.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011779|gb|ADM74943.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011781|gb|ADM74944.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011783|gb|ADM74945.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011785|gb|ADM74946.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011787|gb|ADM74947.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011789|gb|ADM74948.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011791|gb|ADM74949.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011793|gb|ADM74950.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011795|gb|ADM74951.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011797|gb|ADM74952.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011805|gb|ADM74956.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011807|gb|ADM74957.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011811|gb|ADM74959.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011813|gb|ADM74960.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 219 Score = 73.9 bits (180), Expect(2) = 6e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TTV+III RL LVP VGLGIV LADKLGF+ DDKMF F+LLLQHT Sbjct: 123 GLRTTVAIIIARLLLVPPVGLGIVTLADKLGFIPADDKMFRFVLLLQHT 171 Score = 25.4 bits (54), Expect(2) = 6e-13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 263 LYSAAMNLCILLSLGGNLFG 322 + AM CI+L+LGGNL G Sbjct: 96 ILGGAMVPCIMLALGGNLTG 115 >gb|ADM74954.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306011809|gb|ADM74958.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 219 Score = 73.2 bits (178), Expect(2) = 6e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TT++III RL +VP VGLGIV LADKLGF+ DDKMF FILLLQHT Sbjct: 123 GLRTTIAIIIARLLIVPPVGLGIVTLADKLGFIPADDKMFRFILLLQHT 171 Score = 26.2 bits (56), Expect(2) = 6e-13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 263 LYSAAMNLCILLSLGGNLFG 322 + AM CI+L+LGGNL G Sbjct: 96 ILGGAMVPCIMLALGGNLIG 115 >ref|XP_006398552.1| hypothetical protein EUTSA_v10013614mg [Eutrema salsugineum] gi|557099642|gb|ESQ40005.1| hypothetical protein EUTSA_v10013614mg [Eutrema salsugineum] Length = 430 Score = 74.3 bits (181), Expect(2) = 1e-12 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G+KTT +II+ RL LVP VGLGIV LADKLGFL DDKMF F+LLLQHT Sbjct: 335 GFKTTAAIIVGRLVLVPPVGLGIVTLADKLGFLPADDKMFRFVLLLQHT 383 Score = 24.3 bits (51), Expect(2) = 1e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 312 AMIPCILLALGGNL 325 >ref|XP_003623663.1| Auxin efflux carrier component auxin transport protein [Medicago truncatula] gi|355498678|gb|AES79881.1| Auxin efflux carrier component auxin transport protein [Medicago truncatula] Length = 422 Score = 73.9 bits (180), Expect(2) = 1e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G+KTT +I+ RL LVP VGLGIV LADKLGFL PDDKMF F+LLLQH+ Sbjct: 327 GFKTTAAIVFARLVLVPPVGLGIVMLADKLGFLPPDDKMFRFVLLLQHS 375 Score = 24.3 bits (51), Expect(2) = 1e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 304 AMIPCILLALGGNL 317 >ref|NP_195819.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|7340673|emb|CAB82972.1| putative protein [Arabidopsis thaliana] gi|332003034|gb|AED90417.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 431 Score = 73.6 bits (179), Expect(2) = 2e-12 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G+KTT +III RL LVP VGLGIV +ADKLGFL DDKMF F+LLLQHT Sbjct: 336 GFKTTAAIIIGRLVLVPPVGLGIVTVADKLGFLPADDKMFRFVLLLQHT 384 Score = 24.3 bits (51), Expect(2) = 2e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 313 AMIPCILLALGGNL 326 >gb|ADM74933.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 219 Score = 72.4 bits (176), Expect(2) = 2e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TTV+III RL LVP VGLGIV LADKLGF+ DDK+F F+LLLQHT Sbjct: 123 GLRTTVAIIIARLLLVPPVGLGIVTLADKLGFIPADDKIFRFVLLLQHT 171 Score = 25.4 bits (54), Expect(2) = 2e-12 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 263 LYSAAMNLCILLSLGGNLFG 322 + AM CI+L+LGGNL G Sbjct: 96 ILGGAMVPCIMLALGGNLTG 115 >ref|XP_002870888.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297316725|gb|EFH47147.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 430 Score = 73.2 bits (178), Expect(2) = 2e-12 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G+KTT +II RL LVP VGLGIV LADKLGFL DDKMF F+LLLQHT Sbjct: 335 GFKTTAAIIFGRLVLVPPVGLGIVTLADKLGFLPADDKMFRFVLLLQHT 383 Score = 24.3 bits (51), Expect(2) = 2e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 312 AMIPCILLALGGNL 325 >ref|NP_001242551.1| uncharacterized protein LOC100819622 [Glycine max] gi|255645863|gb|ACU23422.1| unknown [Glycine max] Length = 377 Score = 72.4 bits (176), Expect(2) = 4e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G++TT +II RL +VP VGLGIV LADKLGFL PDDKMF F+LLLQH+ Sbjct: 282 GFQTTAAIIFARLLIVPPVGLGIVMLADKLGFLPPDDKMFRFVLLLQHS 330 Score = 24.3 bits (51), Expect(2) = 4e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 259 AMIPCILLALGGNL 272 >ref|XP_006300110.1| hypothetical protein CARUB_v10016338mg [Capsella rubella] gi|482568819|gb|EOA33008.1| hypothetical protein CARUB_v10016338mg [Capsella rubella] Length = 430 Score = 71.6 bits (174), Expect(2) = 6e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G+KTT +II RL LVP VGLGIV LADKLGFL +DKMF F+LLLQHT Sbjct: 335 GFKTTAAIIFGRLVLVPPVGLGIVTLADKLGFLPAEDKMFRFVLLLQHT 383 Score = 24.3 bits (51), Expect(2) = 6e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 312 AMIPCILLALGGNL 325 >gb|AFK37905.1| unknown [Lotus japonicus] Length = 232 Score = 71.6 bits (174), Expect(2) = 6e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TT +I+ RL LVP VGLGIV LADKLGFL PDDKMF F+LLLQH+ Sbjct: 137 GLRTTAAIVFARLVLVPPVGLGIVMLADKLGFLPPDDKMFRFVLLLQHS 185 Score = 24.3 bits (51), Expect(2) = 6e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 114 AMIPCILLALGGNL 127 >gb|ESW12027.1| hypothetical protein PHAVU_008G078600g [Phaseolus vulgaris] Length = 191 Score = 71.6 bits (174), Expect(2) = 6e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G++TT +II RL LVP VGLGIV LADK GFL PDDKMF F+LLLQH+ Sbjct: 96 GFRTTAAIIFARLVLVPPVGLGIVMLADKFGFLPPDDKMFRFVLLLQHS 144 Score = 24.3 bits (51), Expect(2) = 6e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 73 AMIPCILLALGGNL 86 >gb|ESW12026.1| hypothetical protein PHAVU_008G078600g [Phaseolus vulgaris] Length = 151 Score = 71.6 bits (174), Expect(2) = 6e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G++TT +II RL LVP VGLGIV LADK GFL PDDKMF F+LLLQH+ Sbjct: 56 GFRTTAAIIFARLVLVPPVGLGIVMLADKFGFLPPDDKMFRFVLLLQHS 104 Score = 24.3 bits (51), Expect(2) = 6e-12 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 33 AMIPCILLALGGNL 46 >ref|XP_004492601.1| PREDICTED: uncharacterized transporter YBR287W-like [Cicer arietinum] Length = 422 Score = 70.9 bits (172), Expect(2) = 1e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G++TT +I+ RL LVP VGLGIV LADKLGFL P+DKMF F+LLLQH+ Sbjct: 327 GFRTTAAIVFARLVLVPPVGLGIVMLADKLGFLPPNDKMFRFVLLLQHS 375 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 304 AMIPCILLALGGNL 317 >ref|XP_003533648.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Glycine max] gi|571479562|ref|XP_006587896.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Glycine max] Length = 414 Score = 70.9 bits (172), Expect(2) = 1e-11 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G++TT +II RL LVP VGLGIV LADKLGFL DDKMF F+LLLQH+ Sbjct: 319 GFRTTAAIIFARLLLVPLVGLGIVTLADKLGFLPSDDKMFRFVLLLQHS 367 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 296 AMIPCILLALGGNL 309 >ref|XP_002326270.1| predicted protein [Populus trichocarpa] gi|566175683|ref|XP_006381274.1| hypothetical protein POPTR_0006s11290g [Populus trichocarpa] gi|550335975|gb|ERP59071.1| hypothetical protein POPTR_0006s11290g [Populus trichocarpa] Length = 412 Score = 70.9 bits (172), Expect(2) = 1e-11 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G++TT +II RL LVP GLGIV LADKLGFL P DKMF F+LLLQHT Sbjct: 317 GFRTTAAIIFGRLVLVPPAGLGIVTLADKLGFLPPGDKMFKFVLLLQHT 365 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 294 AMIPCILLALGGNL 307 >gb|EMJ08673.1| hypothetical protein PRUPE_ppa006242mg [Prunus persica] gi|462403117|gb|EMJ08674.1| hypothetical protein PRUPE_ppa006242mg [Prunus persica] Length = 421 Score = 70.5 bits (171), Expect(2) = 1e-11 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TTV+III RL LVP VGLGIV LADKLGFL DKMF F+LLLQHT Sbjct: 326 GLRTTVAIIIGRLVLVPPVGLGIVMLADKLGFLPAGDKMFRFVLLLQHT 374 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 303 AMIPCILLALGGNL 316 >ref|XP_004142666.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] gi|449502666|ref|XP_004161708.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 411 Score = 70.5 bits (171), Expect(2) = 1e-11 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G +TT +II RL LVP GLGIV LADKLGFL PDDKMF F+LLLQH+ Sbjct: 316 GLRTTAAIIFARLVLVPPAGLGIVMLADKLGFLPPDDKMFRFVLLLQHS 364 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 293 AMIPCILLALGGNL 306 >ref|XP_006362331.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum tuberosum] Length = 424 Score = 69.7 bits (169), Expect(2) = 2e-11 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 349 GWKTTVSIIIRRLFLVPSVGLGIVNLADKLGFLLPDDKMFCFILLLQHT 495 G+KTTV+I+ RL LVP GLGIV LADKLGFL DDKMF F+LLLQ+T Sbjct: 329 GFKTTVAIVFARLCLVPPTGLGIVMLADKLGFLPADDKMFRFVLLLQYT 377 Score = 24.3 bits (51), Expect(2) = 2e-11 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 275 AMNLCILLSLGGNL 316 AM CILL+LGGNL Sbjct: 304 AMIPCILLALGGNL 317