BLASTX nr result
ID: Ephedra27_contig00019761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00019761 (428 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001140892.1| hypothetical protein [Zea mays] gi|194701616... 56 4e-06 gb|EXB57577.1| hypothetical protein L484_022684 [Morus notabilis] 56 6e-06 ref|NP_001154694.1| pentatricopeptide repeat-containing protein ... 55 7e-06 emb|CAB83319.1| putative protein [Arabidopsis thaliana] 55 7e-06 gb|EMJ06797.1| hypothetical protein PRUPE_ppa008917mg [Prunus pe... 55 9e-06 ref|XP_002530313.1| pentatricopeptide repeat-containing protein,... 55 9e-06 >ref|NP_001140892.1| hypothetical protein [Zea mays] gi|194701616|gb|ACF84892.1| unknown [Zea mays] gi|413919370|gb|AFW59302.1| hypothetical protein ZEAMMB73_030083 [Zea mays] Length = 270 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 343 PFYDPFNKKPVIEEPDDPTDLQEIFHKM 426 P+YDPFNKKP I EP DPT+LQE+FHKM Sbjct: 71 PYYDPFNKKPAIAEPSDPTNLQEVFHKM 98 >gb|EXB57577.1| hypothetical protein L484_022684 [Morus notabilis] Length = 307 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 343 PFYDPFNKKPVIEEPDDPTDLQEIFHKM 426 P YDPF+KKP +EEPDDP DLQEIFHKM Sbjct: 108 PPYDPFSKKPAVEEPDDPKDLQEIFHKM 135 >ref|NP_001154694.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332003244|gb|AED90627.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 363 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 328 QIPTKPFYDPFNKKPVIEEPDDPTDLQEIFHKM 426 Q P P YDPF+KKP IEEP+DP +LQEIFHKM Sbjct: 159 QEPPPPPYDPFSKKPAIEEPEDPKNLQEIFHKM 191 >emb|CAB83319.1| putative protein [Arabidopsis thaliana] Length = 482 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 328 QIPTKPFYDPFNKKPVIEEPDDPTDLQEIFHKM 426 Q P P YDPF+KKP IEEP+DP +LQEIFHKM Sbjct: 140 QEPPPPPYDPFSKKPAIEEPEDPKNLQEIFHKM 172 >gb|EMJ06797.1| hypothetical protein PRUPE_ppa008917mg [Prunus persica] Length = 314 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 343 PFYDPFNKKPVIEEPDDPTDLQEIFHKM 426 P YDPFNKKP IE+P+DP DLQE+FHKM Sbjct: 123 PPYDPFNKKPAIEDPEDPKDLQEVFHKM 150 >ref|XP_002530313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530169|gb|EEF32080.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 328 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +1 Query: 343 PFYDPFNKKPVIEEPDDPTDLQEIFHKM 426 P YDPFNKKPVIEEPDDP +LQ IFHKM Sbjct: 129 PPYDPFNKKPVIEEPDDPNNLQLIFHKM 156