BLASTX nr result
ID: Ephedra27_contig00019314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00019314 (614 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW88847.1| putative cytochrome P450 superfamily protein [Zea... 56 7e-06 >gb|AFW88847.1| putative cytochrome P450 superfamily protein [Zea mays] Length = 484 Score = 56.2 bits (134), Expect = 7e-06 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 18 RYGRVGVYRIFMFEKLTVLT-TPEVCKVMLVGDTEFTEG*PRSRFYLIRHKSF 173 R+GR GVY FMF K TVL TPE CK +L+ D F EG PR+ LI KSF Sbjct: 77 RFGRTGVYMTFMFSKPTVLVATPEACKRVLMDDDSFLEGWPRATVALIGRKSF 129