BLASTX nr result
ID: Ephedra27_contig00018686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00018686 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510066.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002510066.1| conserved hypothetical protein [Ricinus communis] gi|223550767|gb|EEF52253.1| conserved hypothetical protein [Ricinus communis] Length = 425 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = -2 Query: 164 SKRNIKDSLETRQGDNNKQXXXXXERRGVKEDLSVITKGLKRQLWGVASFIAPP 3 SKRN +D ET +G +++ E RGVKEDL+ + + L RQ WGVASF+APP Sbjct: 34 SKRNEQDITETSRGRESEEAEAEAEARGVKEDLTELKQTLTRQFWGVASFLAPP 87