BLASTX nr result
ID: Ephedra27_contig00018182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00018182 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ04706.1| hypothetical protein PRUPE_ppa024790mg, partial [... 56 4e-06 >gb|EMJ04706.1| hypothetical protein PRUPE_ppa024790mg, partial [Prunus persica] Length = 648 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/60 (51%), Positives = 37/60 (61%) Frame = -3 Query: 185 IYKEALQITMDTSNPLYSLQNSTGRVLFKKKFRLWRPSKSSAEDRRVASFKSDFVMNIVP 6 IY A+QIT D SNP S+ N +GR L+KK F+LW K A R A F S FV+NI P Sbjct: 36 IYYSAIQITPDLSNPA-SIVNQSGRFLYKKPFKLWGKGKGGARSR--ALFNSTFVLNITP 92