BLASTX nr result
ID: Ephedra27_contig00017939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00017939 (373 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827777.1| hypothetical protein AMTR_s00009p00265260 [A... 57 3e-06 >ref|XP_006827777.1| hypothetical protein AMTR_s00009p00265260 [Amborella trichopoda] gi|548832397|gb|ERM95193.1| hypothetical protein AMTR_s00009p00265260 [Amborella trichopoda] Length = 490 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 3/65 (4%) Frame = +1 Query: 1 QLEVPRYRLAQVFNWIMELIISRKSWMDHPEQLQECATGLLF---SPSDNEGDILSLLLL 171 +LE PR+ L Q+F W+++ + S K++M HPE LQ C+TGL F S D + ++ LL Sbjct: 421 KLEAPRFPLHQMFLWLLKTVESHKAYMAHPEPLQGCSTGLCFKKDSTEDGQESVIPQKLL 480 Query: 172 HFYAA 186 FY A Sbjct: 481 CFYRA 485