BLASTX nr result
ID: Ephedra27_contig00017872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00017872 (380 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW07538.1| hypothetical protein 0_4530_01, partial [Pinus ra... 77 2e-12 ref|XP_006597383.1| PREDICTED: U-box domain-containing protein 8... 59 9e-07 ref|XP_002876275.1| armadillo/beta-catenin repeat family protein... 58 1e-06 ref|XP_006290746.1| hypothetical protein CARUB_v10016842mg [Caps... 57 2e-06 ref|XP_002311996.1| armadillo/beta-catenin repeat family protein... 57 2e-06 ref|NP_191045.2| U-box domain-containing protein 14 [Arabidopsis... 56 4e-06 ref|XP_006403526.1| hypothetical protein EUTSA_v10010199mg [Eutr... 56 4e-06 emb|CAB41099.1| putative protein [Arabidopsis thaliana] 56 4e-06 ref|XP_004169145.1| PREDICTED: U-box domain-containing protein 8... 56 6e-06 ref|XP_004134742.1| PREDICTED: U-box domain-containing protein 8... 56 6e-06 ref|XP_002518593.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 56 6e-06 ref|XP_002529604.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 56 6e-06 ref|XP_004292907.1| PREDICTED: U-box domain-containing protein 1... 55 1e-05 ref|XP_004163228.1| PREDICTED: U-box domain-containing protein 1... 55 1e-05 ref|XP_004143106.1| PREDICTED: U-box domain-containing protein 1... 55 1e-05 ref|XP_002300058.1| hypothetical protein POPTR_0001s35440g [Popu... 55 1e-05 ref|XP_003635287.1| PREDICTED: U-box domain-containing protein 8... 55 1e-05 >gb|AEW07538.1| hypothetical protein 0_4530_01, partial [Pinus radiata] gi|383159810|gb|AFG62374.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159811|gb|AFG62375.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159812|gb|AFG62376.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159813|gb|AFG62377.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159814|gb|AFG62378.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159815|gb|AFG62379.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159816|gb|AFG62380.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159817|gb|AFG62381.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159818|gb|AFG62382.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159819|gb|AFG62383.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159820|gb|AFG62384.1| hypothetical protein 0_4530_01, partial [Pinus taeda] gi|383159821|gb|AFG62385.1| hypothetical protein 0_4530_01, partial [Pinus taeda] Length = 159 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/70 (50%), Positives = 52/70 (74%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGR A+G+ +M LVR+L+ GT + +EH V+IL+ LCCNS QRA EA +AG + C++ Sbjct: 90 EGRTAIGNHWGIMGTLVRLLKQGTSRSREHAVAILSSLCCNSKQRATEAREAGALEHCRQ 149 Query: 183 LVEDGSSRTK 212 L++DG+ R+K Sbjct: 150 LLDDGTMRSK 159 >ref|XP_006597383.1| PREDICTED: U-box domain-containing protein 8-like [Glycine max] Length = 368 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/80 (36%), Positives = 51/80 (63%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGR + F +Q L R+LR+G+ + ++ + L LCC+S + +EA + GV+ IC+ Sbjct: 281 EGREHMERFRGCVQILTRVLRNGSSRGVQYALMALYSLCCHSEETVVEALRNGVLDICQG 340 Query: 183 LVEDGSSRTKRKATALIKAL 242 LVED +++ KR ++ L++ L Sbjct: 341 LVEDDNAKVKRNSSCLVQLL 360 >ref|XP_002876275.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297322113|gb|EFH52534.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 631 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/86 (32%), Positives = 52/86 (60%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EG+AA+ + ++ + LV I+R G+P+ +E+ +IL LC +++R A + G K Sbjct: 541 EGKAAIAE-AESIPVLVEIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGADVALKE 599 Query: 183 LVEDGSSRTKRKATALIKALEDCPTI 260 L E+G+ R KRKA +L++ ++ + Sbjct: 600 LTENGTDRAKRKAASLLELIQQTEVV 625 >ref|XP_006290746.1| hypothetical protein CARUB_v10016842mg [Capsella rubella] gi|482559453|gb|EOA23644.1| hypothetical protein CARUB_v10016842mg [Capsella rubella] Length = 631 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/81 (35%), Positives = 50/81 (61%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EG+AA+ + +D + LV I+R G+P+ +E+ +IL LC +++R A + G K Sbjct: 541 EGKAAIAE-ADSIPVLVDIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGADIALKE 599 Query: 183 LVEDGSSRTKRKATALIKALE 245 L E+G+ R KRKA +L+ ++ Sbjct: 600 LTENGTDRAKRKAASLLDLIQ 620 >ref|XP_002311996.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222851816|gb|EEE89363.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 628 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/89 (33%), Positives = 52/89 (58%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EG+ A+G D + L+ ++R G+ + +E+ V+IL LC Q+ + A Q G K Sbjct: 540 EGKVAIGQV-DPIPVLIEVIRTGSQRNRENAVAILWSLCTGDSQQLILAKQFGAEEALKE 598 Query: 183 LVEDGSSRTKRKATALIKALEDCPTILEQ 269 L E G+ R KRKA ++++ L+ T+++Q Sbjct: 599 LSESGTDRAKRKAGSILELLQRADTVVDQ 627 >ref|NP_191045.2| U-box domain-containing protein 14 [Arabidopsis thaliana] gi|62287507|sp|Q8VZ40.1|PUB14_ARATH RecName: Full=U-box domain-containing protein 14; AltName: Full=E3 ubiquitin-protein ligase PUB14; AltName: Full=Plant U-box protein 14; AltName: Full=Prototypical U-box domain protein 14 gi|17529090|gb|AAL38755.1| unknown protein [Arabidopsis thaliana] gi|20465441|gb|AAM20180.1| unknown protein [Arabidopsis thaliana] gi|332645779|gb|AEE79300.1| U-box domain-containing protein 14 [Arabidopsis thaliana] Length = 632 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/81 (33%), Positives = 50/81 (61%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EG+ A+ + ++ + LV I+R G+P+ +E+ +IL LC +++R A + G K Sbjct: 542 EGKTAIAE-AESIPVLVEIIRTGSPRNRENAAAILWYLCIGNIERLNVAREVGADVALKE 600 Query: 183 LVEDGSSRTKRKATALIKALE 245 L E+G+ R KRKA +L++ ++ Sbjct: 601 LTENGTDRAKRKAASLLELIQ 621 >ref|XP_006403526.1| hypothetical protein EUTSA_v10010199mg [Eutrema salsugineum] gi|557104645|gb|ESQ44979.1| hypothetical protein EUTSA_v10010199mg [Eutrema salsugineum] Length = 631 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/81 (34%), Positives = 50/81 (61%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EG+ A+ + +D + LV I+R G+P+ +E+ +IL LC +++R A + G K Sbjct: 541 EGKTAIAE-ADSIPVLVEIIRTGSPRNRENAAAILWYLCIGNVERLNVAREVGADIALKE 599 Query: 183 LVEDGSSRTKRKATALIKALE 245 L E+G+ R KRKA +L++ ++ Sbjct: 600 LTENGTDRAKRKAGSLLELIQ 620 >emb|CAB41099.1| putative protein [Arabidopsis thaliana] Length = 639 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/81 (33%), Positives = 50/81 (61%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EG+ A+ + ++ + LV I+R G+P+ +E+ +IL LC +++R A + G K Sbjct: 549 EGKTAIAE-AESIPVLVEIIRTGSPRNRENAAAILWYLCIGNIERLNVAREVGADVALKE 607 Query: 183 LVEDGSSRTKRKATALIKALE 245 L E+G+ R KRKA +L++ ++ Sbjct: 608 LTENGTDRAKRKAASLLELIQ 628 >ref|XP_004169145.1| PREDICTED: U-box domain-containing protein 8-like [Cucumis sativus] Length = 365 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/81 (33%), Positives = 48/81 (59%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGR + F ++ L R+LR+G+P+ ++ + LA LCC+ + +EA + G++ IC Sbjct: 281 EGREEMQWFKGCVEILSRVLRNGSPRGVQYALLTLASLCCHCERLCVEARREGILGICMT 340 Query: 183 LVEDGSSRTKRKATALIKALE 245 L++D S + + A LI L+ Sbjct: 341 LIDDDSEKIRANAANLIHILK 361 >ref|XP_004134742.1| PREDICTED: U-box domain-containing protein 8-like [Cucumis sativus] Length = 365 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/81 (33%), Positives = 48/81 (59%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGR + F ++ L R+LR+G+P+ ++ + LA LCC+ + +EA + G++ IC Sbjct: 281 EGREEMQWFKGCVEILSRVLRNGSPRGVQYALLTLASLCCHCERLCVEARREGILGICMT 340 Query: 183 LVEDGSSRTKRKATALIKALE 245 L++D S + + A LI L+ Sbjct: 341 LIDDDSEKIRANAANLIHILK 361 >ref|XP_002518593.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223542438|gb|EEF43980.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 374 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/83 (33%), Positives = 49/83 (59%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGR + + ++ LV ++++G+ + + + L LCC SL +EA + GV+ IC R Sbjct: 288 EGREEMVRINGCVKVLVNVIKNGSSRGLQCALFTLNCLCCYSLDICLEAIKEGVLEICVR 347 Query: 183 LVEDGSSRTKRKATALIKALEDC 251 LVED + + R A++L++ L C Sbjct: 348 LVEDENEKIMRNASSLVQTLSGC 370 >ref|XP_002529604.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223530937|gb|EEF32796.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 575 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/89 (31%), Positives = 51/89 (57%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EG+ A+G + + LV ++R G+P+ +E+ ++L LC LQ+ A ++G K Sbjct: 485 EGKVAIGQ-AKPIPVLVEVIRTGSPRNRENAAAVLWSLCAGDLQQLKLAKESGAEEALKE 543 Query: 183 LVEDGSSRTKRKATALIKALEDCPTILEQ 269 L E G+ R KRKA +L++ ++ ++ Q Sbjct: 544 LSESGTDRAKRKAGSLLELIQRVEVVVNQ 572 >ref|XP_004292907.1| PREDICTED: U-box domain-containing protein 15-like [Fragaria vesca subsp. vesca] Length = 629 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/83 (36%), Positives = 48/83 (57%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 +GR A+G+FS ++ LV +R+GTPK KE S+L L N+ + + Q GV Sbjct: 545 DGRQAIGEFS-FIETLVEFIREGTPKNKECAASVLLELGSNNSSFLLASLQYGVYEDLVE 603 Query: 183 LVEDGSSRTKRKATALIKALEDC 251 + G++R +RKA AL++ + C Sbjct: 604 ITNSGTNRAQRKARALLQLISKC 626 >ref|XP_004163228.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus] Length = 657 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/91 (30%), Positives = 53/91 (58%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGRAA+G ++ + LV ++ G+P+ +E+ ++L LC + +EA + GV+ + Sbjct: 546 EGRAAIGA-AESVPILVNLIGTGSPRNRENAAAVLVHLCMGDKRHLVEAKELGVIGLLVD 604 Query: 183 LVEDGSSRTKRKATALIKALEDCPTILEQDE 275 + E+G+ R KRKAT L+ + + ++ E Sbjct: 605 MAENGTDRGKRKATQLLDQINRFTELQKEGE 635 >ref|XP_004143106.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus] Length = 657 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/91 (30%), Positives = 53/91 (58%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGRAA+G ++ + LV ++ G+P+ +E+ ++L LC + +EA + GV+ + Sbjct: 546 EGRAAIGA-AESVPILVNLIGTGSPRNRENAAAVLVHLCMGDKRHLVEAKELGVIGLLVD 604 Query: 183 LVEDGSSRTKRKATALIKALEDCPTILEQDE 275 + E+G+ R KRKAT L+ + + ++ E Sbjct: 605 MAENGTDRGKRKATQLLDQINRFTELQKEGE 635 >ref|XP_002300058.1| hypothetical protein POPTR_0001s35440g [Populus trichocarpa] gi|222847316|gb|EEE84863.1| hypothetical protein POPTR_0001s35440g [Populus trichocarpa] Length = 335 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 5/88 (5%) Frame = +3 Query: 33 DMMQGLVRILRDGTPKCKEHTVSILALLC--CNSLQRAMEANQAGVVAICKRLVEDGSSR 206 D ++ V + +GTP+CKEH V IL L+C C R + + GV+ +L DG+ R Sbjct: 215 DAIRAFVETIEEGTPQCKEHAVGILLLICQSCRDKYRGLILRE-GVIPGLLQLSVDGTWR 273 Query: 207 TKRKATALIKALEDCPTI---LEQDEHE 281 K KA L+ L DC + +Q +HE Sbjct: 274 AKEKAKQLLLLLRDCTSYRSRAKQSKHE 301 >ref|XP_003635287.1| PREDICTED: U-box domain-containing protein 8-like [Vitis vinifera] gi|359497783|ref|XP_003635641.1| PREDICTED: U-box domain-containing protein 8-like [Vitis vinifera] gi|147827038|emb|CAN62279.1| hypothetical protein VITISV_042771 [Vitis vinifera] gi|296084802|emb|CBI25940.3| unnamed protein product [Vitis vinifera] Length = 363 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/81 (33%), Positives = 49/81 (60%) Frame = +3 Query: 3 EGRAAVGDFSDMMQGLVRILRDGTPKCKEHTVSILALLCCNSLQRAMEANQAGVVAICKR 182 EGR + F+ ++ LVR+LR+G+ + ++ + L LC N +E + GV+ IC Sbjct: 280 EGREEMEKFNGCVKILVRVLRNGSSRGVQYALMTLNSLCSNGDGMCLETMKEGVLEICMG 339 Query: 183 LVEDGSSRTKRKATALIKALE 245 LVED + + +R A++L++ L+ Sbjct: 340 LVEDDNEKVRRNASSLVQTLQ 360