BLASTX nr result
ID: Ephedra27_contig00017626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00017626 (564 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842625.1| hypothetical protein AMTR_s00077p00182530 [A... 73 6e-11 >ref|XP_006842625.1| hypothetical protein AMTR_s00077p00182530 [Amborella trichopoda] gi|548844711|gb|ERN04300.1| hypothetical protein AMTR_s00077p00182530 [Amborella trichopoda] Length = 1103 Score = 72.8 bits (177), Expect = 6e-11 Identities = 36/66 (54%), Positives = 46/66 (69%) Frame = -2 Query: 200 ETTLDFAAFQLSPKRTRYALYLCGDGETEKLNGWDFGPLLAELPAAKEVLNGSGHVFKLQ 21 ++ LD+AAFQ SPKRT Y Y+ G+G++EKL FGPL A LPA KE + GS +V +LQ Sbjct: 8 DSPLDYAAFQFSPKRTSYEAYVFGEGKSEKLAEGPFGPLAAHLPAVKEQIEGSENVIRLQ 67 Query: 20 LSEEES 3 L E S Sbjct: 68 LPESLS 73