BLASTX 2.2.25 [Feb-01-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Ephedra27_contig00017588
         (429 letters)

Database: ./nr 
           37,332,560 sequences; 13,225,080,153 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|AEW07426.1| hypothetical protein 0_1302_01, partial [Pinus ra...    69   8e-10

>gb|AEW07426.1| hypothetical protein 0_1302_01, partial [Pinus radiata]
           gi|383140914|gb|AFG51782.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140916|gb|AFG51783.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140918|gb|AFG51784.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140920|gb|AFG51785.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140922|gb|AFG51786.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140924|gb|AFG51787.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140926|gb|AFG51788.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140928|gb|AFG51789.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140930|gb|AFG51790.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140932|gb|AFG51791.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140934|gb|AFG51792.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140936|gb|AFG51793.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140938|gb|AFG51794.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140940|gb|AFG51795.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140942|gb|AFG51796.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140944|gb|AFG51797.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140946|gb|AFG51798.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
           gi|383140948|gb|AFG51799.1| hypothetical protein
           0_1302_01, partial [Pinus taeda]
          Length = 153

 Score = 68.6 bits (166), Expect = 8e-10
 Identities = 34/62 (54%), Positives = 46/62 (74%)
 Frame = +3

Query: 12  DSEDESNSVTVTSKGKVQIYSFINGNSALSGEVRCVDSSSPNTSRSYCSKSFLLEHVSSD 191
           + EDE ++    SKGK+Q+ SF+NGN+  SGE+RC++ SSP +S SYCSKSFLLE  S  
Sbjct: 94  EDEDEDDNARSMSKGKIQVMSFVNGNN-FSGELRCIE-SSPKSSVSYCSKSFLLESTSPS 151

Query: 192 SE 197
           S+
Sbjct: 152 SQ 153