BLASTX nr result
ID: Ephedra27_contig00017461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00017461 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK26762.1| unknown [Picea sitchensis] 67 3e-09 gb|AEW08009.1| hypothetical protein 0_16864_01, partial [Pinus r... 65 1e-08 ref|XP_004253081.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 gb|EPS62438.1| hypothetical protein M569_12351, partial [Genlise... 55 7e-06 ref|XP_006644286.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 ref|XP_006590678.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 ref|XP_003537572.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 ref|NP_001043282.1| Os01g0546500 [Oryza sativa Japonica Group] g... 55 1e-05 >gb|ABK26762.1| unknown [Picea sitchensis] Length = 298 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 GW P++ T V +ID FC R D+AK ++ +FKEKG+ K + E+++K GPF P V + Sbjct: 227 GWRPNVATFVSIIDGFCKELRSDEAKAVINQFKEKGFIVDEKAVREYMDKKGPFFPSVWE 286 Query: 183 VILGK 197 V+ GK Sbjct: 287 VMFGK 291 >gb|AEW08009.1| hypothetical protein 0_16864_01, partial [Pinus radiata] gi|383132887|gb|AFG47335.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132889|gb|AFG47336.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132891|gb|AFG47337.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132893|gb|AFG47338.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132895|gb|AFG47339.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132897|gb|AFG47340.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132899|gb|AFG47341.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132901|gb|AFG47342.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132903|gb|AFG47343.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132905|gb|AFG47344.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132907|gb|AFG47345.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132909|gb|AFG47346.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132911|gb|AFG47347.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132913|gb|AFG47348.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132915|gb|AFG47349.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132917|gb|AFG47350.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132919|gb|AFG47351.1| hypothetical protein 0_16864_01, partial [Pinus taeda] gi|383132921|gb|AFG47352.1| hypothetical protein 0_16864_01, partial [Pinus taeda] Length = 129 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/65 (43%), Positives = 42/65 (64%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 GW P++ + V +ID FC R D+AK ++ +FKEKG+ K + E+++K GPF P V + Sbjct: 58 GWRPNVASFVSIIDGFCKELRSDEAKGVINQFKEKGFIADEKAVREYMDKKGPFFPSVWE 117 Query: 183 VILGK 197 I GK Sbjct: 118 AIFGK 122 >ref|XP_004253081.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like isoform 1 [Solanum lycopersicum] gi|460415472|ref|XP_004253082.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like isoform 2 [Solanum lycopersicum] Length = 340 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 G SP++ T V L+D FC + +DA+ ++ ++KG+ K + EFL+K GPF P V + Sbjct: 267 GHSPNVVTFVTLVDGFCKEKSLEDAQNMIKTVRQKGFIVDDKAVREFLDKKGPFLPVVWE 326 Query: 183 VILGK 197 ILGK Sbjct: 327 AILGK 331 >gb|EPS62438.1| hypothetical protein M569_12351, partial [Genlisea aurea] Length = 272 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/64 (39%), Positives = 40/64 (62%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 G+SP+L T GL++ +C + ++AK L+ K+KG+ K + E+L+K GPF V + Sbjct: 200 GYSPNLATFTGLVNGWCQEKGLEEAKTLVGAMKQKGFSVEEKAVREYLDKKGPFSSPVWE 259 Query: 183 VILG 194 ILG Sbjct: 260 AILG 263 >ref|XP_006644286.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Oryza brachyantha] Length = 339 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 G SP+ T VGL+D C A+ ++A+KL+ F+++ + K I E L+K GPF P + + Sbjct: 268 GHSPNAMTFVGLVDGVCKAKGVEEAEKLVRSFQDRNFAIDEKSIREHLDKKGPFSPVIWE 327 Query: 183 VILGK 197 VI GK Sbjct: 328 VIFGK 332 >ref|XP_006590678.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like isoform X2 [Glycine max] Length = 395 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/65 (38%), Positives = 39/65 (60%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 G SP++ T VGL+D FC+ + ++AK + +KG+ K + +FL+K PF P V + Sbjct: 324 GHSPNVTTFVGLVDGFCNEKGVEEAKSAIKTLTDKGFVVNEKAVRQFLDKKAPFSPSVWE 383 Query: 183 VILGK 197 I GK Sbjct: 384 AIFGK 388 >ref|XP_003537572.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like isoform X1 [Glycine max] Length = 388 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/65 (38%), Positives = 39/65 (60%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 G SP++ T VGL+D FC+ + ++AK + +KG+ K + +FL+K PF P V + Sbjct: 317 GHSPNVTTFVGLVDGFCNEKGVEEAKSAIKTLTDKGFVVNEKAVRQFLDKKAPFSPSVWE 376 Query: 183 VILGK 197 I GK Sbjct: 377 AIFGK 381 >ref|NP_001043282.1| Os01g0546500 [Oryza sativa Japonica Group] gi|20146451|dbj|BAB89231.1| fertility restorer -like protein [Oryza sativa Japonica Group] gi|113532813|dbj|BAF05196.1| Os01g0546500 [Oryza sativa Japonica Group] gi|215697396|dbj|BAG91390.1| unnamed protein product [Oryza sativa Japonica Group] gi|222618638|gb|EEE54770.1| hypothetical protein OsJ_02158 [Oryza sativa Japonica Group] Length = 342 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = +3 Query: 3 GWSPDLPTIVGLIDSFCHAERRDDAKKLLFEFKEKGYDPRAKFIVEFLEKHGPFHPHVRD 182 G SP+ T VGL+D C A+ ++A+KL+ F+++ + K I E L+K GPF P + + Sbjct: 271 GHSPNAMTFVGLVDEVCKAKGVEEAEKLVRSFQDRNFAIDEKSIREHLDKKGPFSPVIWE 330 Query: 183 VILGK 197 VI GK Sbjct: 331 VIFGK 335