BLASTX nr result
ID: Ephedra27_contig00016811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00016811 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN40140.1| unknown [Picea sitchensis] 57 2e-06 gb|ABK26234.1| unknown [Picea sitchensis] 57 2e-06 >gb|ACN40140.1| unknown [Picea sitchensis] Length = 387 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 5 ELLTAGLEGYVNQTKRVETHFEKIWPPPNV 94 ELL AGLEGY+NQ+KRVE +F KIWPPPNV Sbjct: 358 ELLAAGLEGYINQSKRVEAYFTKIWPPPNV 387 >gb|ABK26234.1| unknown [Picea sitchensis] Length = 387 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 5 ELLTAGLEGYVNQTKRVETHFEKIWPPPNV 94 ELL AGLEGY+NQ+KRVE +F KIWPPPNV Sbjct: 358 ELLAAGLEGYINQSKRVEAYFTKIWPPPNV 387