BLASTX nr result
ID: Ephedra27_contig00016617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00016617 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481823.1| PREDICTED: BTB/POZ domain-containing protein... 55 1e-05 ref|XP_006481822.1| PREDICTED: BTB/POZ domain-containing protein... 55 1e-05 ref|XP_006430264.1| hypothetical protein CICLE_v10011131mg [Citr... 55 1e-05 >ref|XP_006481823.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X2 [Citrus sinensis] Length = 943 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 4/94 (4%) Frame = +3 Query: 105 DSDLIVLEIHNIKPNRIE----QDHECIQSTSPCSEIPLRAWEMCSISHISVSQRQVIKV 272 D +VL N+ P IE +D E + ST+ +R+W++ +I H Q +KV Sbjct: 6 DDIFVVLTCTNLNPIPIEADIAEDGEILISTND-----IRSWDLDTILH-----HQTVKV 55 Query: 273 LVHRSRLVENSQYFRSLFEGGFKEALSDYAILEW 374 R RL+E S YF+ L G F E+ SDY ++W Sbjct: 56 HASRDRLIEQSSYFQGLLGGSFSESSSDYISIQW 89 >ref|XP_006481822.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X1 [Citrus sinensis] Length = 966 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 4/94 (4%) Frame = +3 Query: 105 DSDLIVLEIHNIKPNRIE----QDHECIQSTSPCSEIPLRAWEMCSISHISVSQRQVIKV 272 D +VL N+ P IE +D E + ST+ +R+W++ +I H Q +KV Sbjct: 6 DDIFVVLTCTNLNPIPIEADIAEDGEILISTND-----IRSWDLDTILH-----HQTVKV 55 Query: 273 LVHRSRLVENSQYFRSLFEGGFKEALSDYAILEW 374 R RL+E S YF+ L G F E+ SDY ++W Sbjct: 56 HASRDRLIEQSSYFQGLLGGSFSESSSDYISIQW 89 >ref|XP_006430264.1| hypothetical protein CICLE_v10011131mg [Citrus clementina] gi|557532321|gb|ESR43504.1| hypothetical protein CICLE_v10011131mg [Citrus clementina] Length = 760 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 4/94 (4%) Frame = +3 Query: 105 DSDLIVLEIHNIKPNRIE----QDHECIQSTSPCSEIPLRAWEMCSISHISVSQRQVIKV 272 D +VL N+ P IE +D + + ST+ +R+W++ +I H+ Q +KV Sbjct: 6 DDTFVVLTCTNLNPIPIEADIAEDGKILISTND-----IRSWDLDTILHL-----QTVKV 55 Query: 273 LVHRSRLVENSQYFRSLFEGGFKEALSDYAILEW 374 R RL+E S YF+ L G F E+ SDY ++W Sbjct: 56 HASRDRLIEQSSYFQGLLGGSFSESSSDYISIQW 89