BLASTX nr result
ID: Ephedra27_contig00016487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00016487 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT18027.1| Sentrin-specific protease 1 [Aegilops tauschii] 62 1e-07 gb|EMS57113.1| Ubiquitin-like-specific protease ESD4 [Triticum u... 61 2e-07 ref|XP_006650065.1| PREDICTED: ubiquitin-like-specific protease ... 56 4e-06 ref|XP_002465291.1| hypothetical protein SORBIDRAFT_01g035640 [S... 56 4e-06 ref|XP_004984418.1| PREDICTED: ubiquitin-like-specific protease ... 56 6e-06 ref|XP_003557935.1| PREDICTED: ubiquitin-like-specific protease ... 56 6e-06 >gb|EMT18027.1| Sentrin-specific protease 1 [Aegilops tauschii] Length = 511 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/57 (47%), Positives = 41/57 (71%) Frame = -2 Query: 367 WTKDTIEGLSIQSNMWDCGMFILKYAEYFSRGATTLDFGQDDIKKFRYVVRDQLLRL 197 WTK++I+ + +Q N WDCGMF+LKY ++ SRG +L FGQ+ ++ FR ++LRL Sbjct: 453 WTKESIDCIPLQENGWDCGMFMLKYIDFHSRG-VSLSFGQEHMEYFRRRTAKEILRL 508 >gb|EMS57113.1| Ubiquitin-like-specific protease ESD4 [Triticum urartu] Length = 199 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = -2 Query: 367 WTKDTIEGLSIQSNMWDCGMFILKYAEYFSRGATTLDFGQDDIKKFRYVVRDQLLRL 197 WTK++I+ + +Q N WDCGMF+LKY ++ SRG L FGQ+ ++ FR ++LRL Sbjct: 141 WTKESIDRIPLQENGWDCGMFMLKYIDFHSRG-VGLSFGQEHMEYFRRRTAKEILRL 196 >ref|XP_006650065.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Oryza brachyantha] Length = 411 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/57 (43%), Positives = 39/57 (68%) Frame = -2 Query: 367 WTKDTIEGLSIQSNMWDCGMFILKYAEYFSRGATTLDFGQDDIKKFRYVVRDQLLRL 197 W +D++ + +Q N WDCGMF+LKY ++ SRG +L F Q+D++ FR ++LRL Sbjct: 353 WHEDSVGYIPLQQNGWDCGMFMLKYIDFHSRG-LSLSFSQEDMEYFRKRTVKEILRL 408 >ref|XP_002465291.1| hypothetical protein SORBIDRAFT_01g035640 [Sorghum bicolor] gi|241919145|gb|EER92289.1| hypothetical protein SORBIDRAFT_01g035640 [Sorghum bicolor] Length = 409 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = -2 Query: 367 WTKDTIEGLSIQSNMWDCGMFILKYAEYFSRGATTLDFGQDDIKKFRYVVRDQLLRL 197 W ++ ++G+ +Q N WDCGMF+LKY ++ SRG L F Q+ ++ FR ++LRL Sbjct: 351 WHEELVDGIPLQQNGWDCGMFMLKYIDFHSRG-LPLSFSQEHMEYFRKRTAKEILRL 406 >ref|XP_004984418.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Setaria italica] Length = 417 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = -2 Query: 367 WTKDTIEGLSIQSNMWDCGMFILKYAEYFSRGATTLDFGQDDIKKFRYVVRDQLLRL 197 W +D ++ + +Q N WDCGMF+LKY ++ SRG +L F Q D++ FR ++L+L Sbjct: 359 WQEDIVDDIPLQQNGWDCGMFMLKYIDFHSRG-LSLSFRQKDMEYFRKRTAKEILKL 414 >ref|XP_003557935.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Brachypodium distachyon] Length = 403 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/57 (42%), Positives = 40/57 (70%) Frame = -2 Query: 367 WTKDTIEGLSIQSNMWDCGMFILKYAEYFSRGATTLDFGQDDIKKFRYVVRDQLLRL 197 W + +++ + +Q N WDCGMF+LKY +++SRG +L FGQ+ ++ FR ++LRL Sbjct: 345 WKEASLDYVPLQQNGWDCGMFMLKYIDFYSRG-LSLSFGQEHMEYFRMRTVKEILRL 400