BLASTX nr result
ID: Ephedra27_contig00016114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00016114 (552 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06501.1| hypothetical protein PRUPE_ppa006777mg [Prunus pe... 56 5e-06 >gb|EMJ06501.1| hypothetical protein PRUPE_ppa006777mg [Prunus persica] Length = 395 Score = 56.2 bits (134), Expect = 5e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -3 Query: 547 TEVGNCDPLRHLIPYWSCFSCTEDIWCIKKL 455 TEVG CDP++H IP+W SC+ED+WCIK L Sbjct: 341 TEVGGCDPVKHYIPHWKLLSCSEDLWCIKPL 371