BLASTX nr result
ID: Ephedra27_contig00015745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00015745 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_566966.1| aspartyl protease family protein [Arabidopsis t... 71 1e-10 ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223... 70 4e-10 ref|XP_006291053.1| hypothetical protein CARUB_v10017168mg [Caps... 68 1e-09 ref|XP_006403798.1| hypothetical protein EUTSA_v10010339mg [Eutr... 68 1e-09 dbj|BAK04810.1| predicted protein [Hordeum vulgare subsp. vulgare] 68 1e-09 ref|XP_006481530.1| PREDICTED: aspartic proteinase nepenthesin-1... 67 2e-09 ref|XP_002312826.2| hypothetical protein POPTR_0009s16390g [Popu... 67 2e-09 ref|XP_006424129.1| hypothetical protein CICLE_v10028374mg [Citr... 67 2e-09 ref|XP_002309394.1| aspartyl protease family protein [Populus tr... 66 4e-09 gb|AAL14384.1| AT3g52500/F22O6_120 [Arabidopsis thaliana] 66 4e-09 ref|XP_004960001.1| PREDICTED: aspartic proteinase nepenthesin-1... 66 5e-09 ref|XP_002877867.1| aspartyl protease family protein [Arabidopsi... 65 7e-09 emb|CBI28265.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2... 65 7e-09 emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] 65 7e-09 ref|XP_004494242.1| PREDICTED: aspartic proteinase nepenthesin-1... 65 9e-09 ref|XP_002323393.2| hypothetical protein POPTR_0016s07260g [Popu... 64 2e-08 gb|EMJ01345.1| hypothetical protein PRUPE_ppa016981mg [Prunus pe... 64 2e-08 emb|CBI30372.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002280866.1| PREDICTED: aspartic proteinase nepenthesin-2... 64 2e-08 >ref|NP_566966.1| aspartyl protease family protein [Arabidopsis thaliana] gi|13430562|gb|AAK25903.1|AF360193_1 unknown protein [Arabidopsis thaliana] gi|4886277|emb|CAB43423.1| putative protein [Arabidopsis thaliana] gi|14532764|gb|AAK64083.1| unknown protein [Arabidopsis thaliana] gi|15450892|gb|AAK96717.1| Unknown protein [Arabidopsis thaliana] gi|30387567|gb|AAP31949.1| At3g52500 [Arabidopsis thaliana] gi|332645431|gb|AEE78952.1| aspartyl protease family protein [Arabidopsis thaliana] Length = 469 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -3 Query: 164 STVSARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 S +SA+ YGGYS++L+ GTP+Q++ V DTGS LVW+PCT Y C CD S Sbjct: 80 SPLSAKSYGGYSVSLSFGTPSQTIPFVFDTGSSLVWLPCTSRYLCSGCDFS 130 >ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223525662|gb|EEF28148.1| pepsin A, putative [Ricinus communis] Length = 468 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/45 (57%), Positives = 38/45 (84%) Frame = -3 Query: 152 ARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACD 18 +R YGGYS++L++GTP+Q+V+L++DTGS LVW PCT Y C +C+ Sbjct: 78 SRSYGGYSMSLSLGTPSQTVKLIMDTGSSLVWFPCTSRYVCASCN 122 >ref|XP_006291053.1| hypothetical protein CARUB_v10017168mg [Capsella rubella] gi|482559760|gb|EOA23951.1| hypothetical protein CARUB_v10017168mg [Capsella rubella] Length = 471 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 164 STVSARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 S +SA+ YGGYS++L+ GTP+Q++ V DTGS LVW PCT Y C C S Sbjct: 82 SPLSAKSYGGYSVSLSFGTPSQTIPFVFDTGSSLVWFPCTSRYLCSGCSFS 132 >ref|XP_006403798.1| hypothetical protein EUTSA_v10010339mg [Eutrema salsugineum] gi|557104917|gb|ESQ45251.1| hypothetical protein EUTSA_v10010339mg [Eutrema salsugineum] Length = 471 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 164 STVSARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 S +S R YGGYS++L+ GTP+Q++ V DTGS LVW PCT Y C C+ S Sbjct: 86 SPLSPRSYGGYSVSLSFGTPSQTIPFVFDTGSSLVWFPCTSRYLCSGCNFS 136 >dbj|BAK04810.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 488 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/86 (36%), Positives = 47/86 (54%) Frame = -3 Query: 263 QHRRVVQMVEATKARARSLXXXXXXXXXXXTAASTVSARGYGGYSITLTVGTPAQSVRLV 84 QH + ++ A+ ARA L + + YGGY+ +L++GTP Q + ++ Sbjct: 43 QHHPLSRLARASLARASRLRGHHQGQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVL 102 Query: 83 LDTGSDLVWMPCTFNYTCLACDSSDG 6 LDTGS L W+PCT NY C C ++ G Sbjct: 103 LDTGSHLTWVPCTSNYQCQNCSAAAG 128 >ref|XP_006481530.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Citrus sinensis] Length = 465 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 2/96 (2%) Frame = -3 Query: 293 TEMHTRLHTIQHRRVVQMVEATKARARSLXXXXXXXXXXXTAAST--VSARGYGGYSITL 120 + HT ++ + +V ++ RA + T +T +S+ YGGYSI+L Sbjct: 34 SRFHTNPSQDSYQNLNSLVSSSLTRALHIKNPQTKTTTTTTTTTTTNISSHSYGGYSISL 93 Query: 119 TVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 + GTP Q + +LDTGS LVW PCT +Y C C SS Sbjct: 94 SFGTPPQIIPFILDTGSHLVWFPCTNHYQCKYCSSS 129 >ref|XP_002312826.2| hypothetical protein POPTR_0009s16390g [Populus trichocarpa] gi|550331863|gb|EEE86781.2| hypothetical protein POPTR_0009s16390g [Populus trichocarpa] Length = 462 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/84 (39%), Positives = 50/84 (59%) Frame = -3 Query: 263 QHRRVVQMVEATKARARSLXXXXXXXXXXXTAASTVSARGYGGYSITLTVGTPAQSVRLV 84 Q++++ +V + ARAR L TA + + YGGYS++L+ GTP Q++ + Sbjct: 42 QYQKLNHLVTTSLARARHLKNPQTTPATTTTAP--LFSHSYGGYSVSLSFGTPPQTLSFI 99 Query: 83 LDTGSDLVWMPCTFNYTCLACDSS 12 +DTGSD+VW PCT +Y C C S Sbjct: 100 MDTGSDIVWFPCTSHYLCKHCSFS 123 >ref|XP_006424129.1| hypothetical protein CICLE_v10028374mg [Citrus clementina] gi|557526063|gb|ESR37369.1| hypothetical protein CICLE_v10028374mg [Citrus clementina] Length = 467 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 164 STVSARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 + +S+ YGGYSI+L+ GTP Q + +LDTGS LVW PCT +Y C C SS Sbjct: 81 TNISSHSYGGYSISLSFGTPPQIIPFILDTGSHLVWFPCTNHYQCKYCSSS 131 >ref|XP_002309394.1| aspartyl protease family protein [Populus trichocarpa] gi|222855370|gb|EEE92917.1| aspartyl protease family protein [Populus trichocarpa] Length = 469 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -3 Query: 149 RGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACD 18 R YGGYSI+L GTP Q+ + V+DTGS LVW PCT Y C CD Sbjct: 87 RSYGGYSISLNFGTPPQTTKFVMDTGSSLVWFPCTSRYLCSRCD 130 >gb|AAL14384.1| AT3g52500/F22O6_120 [Arabidopsis thaliana] Length = 469 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = -3 Query: 164 STVSARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 S +SA+ YGGYS++L+ GTP+Q++ V DTGS LV +PCT Y C CD S Sbjct: 80 SPLSAKSYGGYSVSLSFGTPSQTIPFVFDTGSSLVCLPCTSRYLCSGCDFS 130 >ref|XP_004960001.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Setaria italica] Length = 518 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/91 (32%), Positives = 46/91 (50%) Frame = -3 Query: 284 HTRLHTIQHRRVVQMVEATKARARSLXXXXXXXXXXXTAASTVSARGYGGYSITLTVGTP 105 H H + ++ A+ ARA L ++ + YGGY+ T ++GTP Sbjct: 83 HVATEAAHHHPLSRLAAASLARASHLRRPAPAHHKAQGGSTALYPHSYGGYAFTASLGTP 142 Query: 104 AQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 Q + ++LDTGS L W+PCT NY C C ++ Sbjct: 143 PQPLPVLLDTGSHLTWVPCTSNYQCRNCPTA 173 >ref|XP_002877867.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata] gi|297323705|gb|EFH54126.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata] Length = 469 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 164 STVSARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDSS 12 S +S + YGGYS++L+ GTP+Q++ V DTGS LVW PCT Y C C+ S Sbjct: 80 SHLSPKSYGGYSVSLSFGTPSQTIPFVFDTGSSLVWFPCTSRYLCSDCNFS 130 >emb|CBI28265.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/83 (39%), Positives = 45/83 (54%) Frame = -3 Query: 260 HRRVVQMVEATKARARSLXXXXXXXXXXXTAASTVSARGYGGYSITLTVGTPAQSVRLVL 81 +R + +V A+ RAR L + + + YG YSI L+ GTP Q++ L++ Sbjct: 52 YRNLRHLVSASLIRARHLKNPKTTPT----STTPLFTHSYGAYSIPLSFGTPPQTLPLIM 107 Query: 80 DTGSDLVWMPCTFNYTCLACDSS 12 DTGSDLVW PCT Y C C S Sbjct: 108 DTGSDLVWFPCTHRYVCRNCSFS 130 >ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 467 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/83 (39%), Positives = 45/83 (54%) Frame = -3 Query: 260 HRRVVQMVEATKARARSLXXXXXXXXXXXTAASTVSARGYGGYSITLTVGTPAQSVRLVL 81 +R + +V A+ RAR L + + + YG YSI L+ GTP Q++ L++ Sbjct: 52 YRNLRHLVSASLIRARHLKNPKTTPT----STTPLFTHSYGAYSIPLSFGTPPQTLPLIM 107 Query: 80 DTGSDLVWMPCTFNYTCLACDSS 12 DTGSDLVW PCT Y C C S Sbjct: 108 DTGSDLVWFPCTHRYVCRNCSFS 130 >emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] Length = 454 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/83 (39%), Positives = 45/83 (54%) Frame = -3 Query: 260 HRRVVQMVEATKARARSLXXXXXXXXXXXTAASTVSARGYGGYSITLTVGTPAQSVRLVL 81 +R + +V A+ RAR L + + + YG YSI L+ GTP Q++ L++ Sbjct: 52 YRNLRHLVSASLIRARHLKNPKTTPT----STTPLFTHSYGAYSIPLSFGTPPQTLPLIM 107 Query: 80 DTGSDLVWMPCTFNYTCLACDSS 12 DTGSDLVW PCT Y C C S Sbjct: 108 DTGSDLVWFPCTHRYVCRNCSFS 130 >ref|XP_004494242.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cicer arietinum] Length = 474 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -3 Query: 158 VSARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACD 18 V A+ YGGYSI L GTP Q++ VLDTGS LVW PCT +Y C C+ Sbjct: 83 VFAKSYGGYSINLNFGTPPQTLSFVLDTGSSLVWFPCTSHYLCSNCN 129 >ref|XP_002323393.2| hypothetical protein POPTR_0016s07260g [Populus trichocarpa] gi|550321034|gb|EEF05154.2| hypothetical protein POPTR_0016s07260g [Populus trichocarpa] Length = 454 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -3 Query: 149 RGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACD 18 R YGGYSI+L GTP Q+ + V+DTGS LVW PCT Y C C+ Sbjct: 78 RSYGGYSISLNFGTPPQTTKFVMDTGSSLVWFPCTSRYLCSECN 121 >gb|EMJ01345.1| hypothetical protein PRUPE_ppa016981mg [Prunus persica] Length = 460 Score = 64.3 bits (155), Expect = 2e-08 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -3 Query: 152 ARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLACDS 15 + YGGYSI L+ GTP Q++ ++DTGSDL+W PC+ NY C+ C + Sbjct: 82 SNSYGGYSIPLSFGTPPQTLPFIMDTGSDLIWFPCSKNYQCINCST 127 >emb|CBI30372.3| unnamed protein product [Vitis vinifera] Length = 445 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 152 ARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLAC 21 A YGGYS++L+ GTP+Q++ V+DTGS LVW PCT Y C C Sbjct: 100 AHSYGGYSVSLSFGTPSQTLSFVMDTGSSLVWFPCTSRYVCTRC 143 >ref|XP_002280866.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 469 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 152 ARGYGGYSITLTVGTPAQSVRLVLDTGSDLVWMPCTFNYTCLAC 21 A YGGYS++L+ GTP+Q++ V+DTGS LVW PCT Y C C Sbjct: 84 AHSYGGYSVSLSFGTPSQTLSFVMDTGSSLVWFPCTSRYVCTRC 127