BLASTX nr result
ID: Ephedra27_contig00015694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00015694 (481 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845971.1| hypothetical protein AMTR_s00155p00007590 [A... 71 2e-10 ref|XP_006826682.1| hypothetical protein AMTR_s00137p00066590 [A... 68 1e-09 ref|XP_002264014.2| PREDICTED: uncharacterized protein At3g49720... 63 4e-08 emb|CBI25887.3| unnamed protein product [Vitis vinifera] 63 4e-08 emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] 63 4e-08 ref|XP_002300295.1| hypothetical protein POPTR_0001s29510g [Popu... 55 1e-05 >ref|XP_006845971.1| hypothetical protein AMTR_s00155p00007590 [Amborella trichopoda] gi|548848727|gb|ERN07646.1| hypothetical protein AMTR_s00155p00007590 [Amborella trichopoda] Length = 261 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 343 MSRRPVNPMARRFVDSTVTPSTSPLHQKSRSSPLLSIGLVLLGAFL 480 MSRR VNP+ARRF DS+ P +S LHQKSRSSPLLS+GL+L+GAFL Sbjct: 1 MSRRQVNPIARRFADSSSLPVSSSLHQKSRSSPLLSVGLILVGAFL 46 >ref|XP_006826682.1| hypothetical protein AMTR_s00137p00066590 [Amborella trichopoda] gi|548831083|gb|ERM93919.1| hypothetical protein AMTR_s00137p00066590 [Amborella trichopoda] Length = 262 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +1 Query: 343 MSRRPVNPMARRFVDSTVTPSTSPLHQKSRSSPLLSIGLVLLGAFL 480 MSRR VNP ARRF +S+ P S LHQKSRSSPLLS+GL+L+GAFL Sbjct: 1 MSRRQVNPNARRFAESSSLPVASALHQKSRSSPLLSVGLILVGAFL 46 >ref|XP_002264014.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] Length = 203 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = +1 Query: 343 MSRRPVNPMARRFVDSTVTPSTSPLHQKSRSSPLLSIGLVLLGAFL 480 MSRR VNP +RRFVDS P LH KSRSSPLLSIGLVLLGAFL Sbjct: 1 MSRRQVNP-SRRFVDSGSIPFAGALHSKSRSSPLLSIGLVLLGAFL 45 >emb|CBI25887.3| unnamed protein product [Vitis vinifera] Length = 150 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = +1 Query: 343 MSRRPVNPMARRFVDSTVTPSTSPLHQKSRSSPLLSIGLVLLGAFL 480 MSRR VNP +RRFVDS P LH KSRSSPLLSIGLVLLGAFL Sbjct: 1 MSRRQVNP-SRRFVDSGSIPFAGALHSKSRSSPLLSIGLVLLGAFL 45 >emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] Length = 256 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = +1 Query: 343 MSRRPVNPMARRFVDSTVTPSTSPLHQKSRSSPLLSIGLVLLGAFL 480 MSRR VNP +RRFVDS P LH KSRSSPLLSIGLVLLGAFL Sbjct: 1 MSRRQVNP-SRRFVDSGSIPFAGALHSKSRSSPLLSIGLVLLGAFL 45 >ref|XP_002300295.1| hypothetical protein POPTR_0001s29510g [Populus trichocarpa] gi|566151686|ref|XP_006369709.1| hypothetical protein POPTR_0001s29510g [Populus trichocarpa] gi|118484269|gb|ABK94014.1| unknown [Populus trichocarpa] gi|222847553|gb|EEE85100.1| hypothetical protein POPTR_0001s29510g [Populus trichocarpa] gi|550348480|gb|ERP66278.1| hypothetical protein POPTR_0001s29510g [Populus trichocarpa] Length = 262 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 343 MSRRPVNPMARRFVDSTVTPSTSPLHQKSRSSPLLSIGLVLLGAFL 480 MSRRP NP ARRF D P +H KSRSSPLLSIGL+++GA L Sbjct: 1 MSRRPGNP-ARRFADGGSLPFVGSMHSKSRSSPLLSIGLLVVGAIL 45