BLASTX nr result
ID: Ephedra27_contig00015506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00015506 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314749.2| glutamate decarboxylase family protein [Popu... 60 4e-07 ref|XP_002270937.1| PREDICTED: glutamate decarboxylase 1 [Vitis ... 59 7e-07 emb|CBI26756.3| unnamed protein product [Vitis vinifera] 59 9e-07 gb|ACN41071.1| unknown [Picea sitchensis] 59 9e-07 ref|XP_002521892.1| glutamate decarboxylase, putative [Ricinus c... 59 9e-07 ref|XP_006448050.1| hypothetical protein CICLE_v10015017mg [Citr... 58 1e-06 ref|XP_004237250.1| PREDICTED: glutamate decarboxylase 4-like [S... 58 1e-06 ref|NP_001275838.1| glutamate decarboxylase-like [Citrus sinensi... 58 1e-06 gb|AAK38667.1|AF353615_1 glutamate decarboxylase isozyme 3 [Nico... 58 1e-06 ref|XP_006368084.1| PREDICTED: glutamate decarboxylase 3-like [S... 57 2e-06 gb|AHC56661.1| glutamate decarboxylase 2 [Malus domestica] 57 3e-06 ref|XP_006391332.1| hypothetical protein EUTSA_v10019820mg [Eutr... 57 3e-06 gb|ESW13943.1| hypothetical protein PHAVU_008G2397001g, partial ... 57 3e-06 gb|AAS79669.1| glutamate decarboxylase 2 [Brassica juncea] 57 3e-06 ref|XP_002285267.1| PREDICTED: glutamate decarboxylase 1 [Vitis ... 56 4e-06 emb|CAN67952.1| hypothetical protein VITISV_028884 [Vitis vinifera] 56 4e-06 sp|Q07346.1|DCE_PETHY RecName: Full=Glutamate decarboxylase; Sho... 56 6e-06 ref|XP_002886996.1| glutamate decarboxylase 2 [Arabidopsis lyrat... 56 6e-06 ref|XP_002327596.1| predicted protein [Populus trichocarpa] gi|5... 56 6e-06 gb|ABA18653.1| glutamate decarboxylase [Pinus pinaster] 56 6e-06 >ref|XP_002314749.2| glutamate decarboxylase family protein [Populus trichocarpa] gi|550329553|gb|EEF00920.2| glutamate decarboxylase family protein [Populus trichocarpa] Length = 502 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPV 128 I++LRVV+REDFSR++AERLVRDI KVL EL LPAK+S + Sbjct: 415 ITVLRVVIREDFSRTLAERLVRDITKVLHELDSLPAKLSAKI 456 >ref|XP_002270937.1| PREDICTED: glutamate decarboxylase 1 [Vitis vinifera] gi|297738155|emb|CBI27356.3| unnamed protein product [Vitis vinifera] Length = 488 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQET 137 +++LRVV+REDFSR++AERLV DI KVL EL LPAKI+ VQ++ Sbjct: 414 VTVLRVVIREDFSRTLAERLVTDIQKVLYELDTLPAKITAKVQQS 458 >emb|CBI26756.3| unnamed protein product [Vitis vinifera] Length = 462 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQET 137 +++LRVVVREDFSR++AERLV DI KVL EL LPAK+S + +T Sbjct: 414 VTVLRVVVREDFSRTLAERLVFDITKVLHELDMLPAKLSAKISKT 458 >gb|ACN41071.1| unknown [Picea sitchensis] Length = 509 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPV 128 ++LLRVVVREDF+RS+AERLVRDI KVL EL LP+K+ T V Sbjct: 413 VTLLRVVVREDFNRSLAERLVRDIEKVLHELDALPSKLVTEV 454 >ref|XP_002521892.1| glutamate decarboxylase, putative [Ricinus communis] gi|223538930|gb|EEF40528.1| glutamate decarboxylase, putative [Ricinus communis] Length = 180 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPV 128 I++LRVV+REDFSR++AERLV DI KVL EL LPAKIS V Sbjct: 92 ITVLRVVIREDFSRTLAERLVLDITKVLHELDQLPAKISAKV 133 >ref|XP_006448050.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] gi|557550661|gb|ESR61290.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] Length = 364 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQE 134 I++LRVV+REDFSR++AERLV DI KVL EL LP+K+ P E Sbjct: 284 ITVLRVVIREDFSRTLAERLVLDITKVLHELDSLPSKVLVPASE 327 >ref|XP_004237250.1| PREDICTED: glutamate decarboxylase 4-like [Solanum lycopersicum] Length = 493 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQE 134 I++LRVV+REDFSR++AERLV DI+KVL EL LPA++S ++E Sbjct: 414 ITVLRVVIREDFSRTLAERLVFDIVKVLHELDTLPARLSAKMEE 457 >ref|NP_001275838.1| glutamate decarboxylase-like [Citrus sinensis] gi|567911471|ref|XP_006448049.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] gi|70609690|gb|AAZ05070.1| glutamate decarboxylase [Citrus sinensis] gi|557550660|gb|ESR61289.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] Length = 494 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQE 134 I++LRVV+REDFSR++AERLV DI KVL EL LP+K+ P E Sbjct: 414 ITVLRVVIREDFSRTLAERLVLDITKVLHELDSLPSKVLVPASE 457 >gb|AAK38667.1|AF353615_1 glutamate decarboxylase isozyme 3 [Nicotiana tabacum] Length = 491 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQE 134 +++LRVV+REDFSR++AERLV DI+KVL EL LPA++S ++E Sbjct: 414 VTVLRVVIREDFSRTLAERLVLDIVKVLHELDTLPARLSAKLEE 457 >ref|XP_006368084.1| PREDICTED: glutamate decarboxylase 3-like [Solanum tuberosum] Length = 153 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQE 134 +++LRVV+REDFSR++AERLV DI+KVL EL LPA++S ++E Sbjct: 71 VTVLRVVIREDFSRTLAERLVFDIVKVLHELDTLPARLSAKMEE 114 >gb|AHC56661.1| glutamate decarboxylase 2 [Malus domestica] Length = 501 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQ 131 I++LRVV+REDFSR++AERLV DI KVL+EL LP+K+S+ V+ Sbjct: 414 ITVLRVVIREDFSRTLAERLVNDIKKVLRELDTLPSKLSSNVK 456 >ref|XP_006391332.1| hypothetical protein EUTSA_v10019820mg [Eutrema salsugineum] gi|557087766|gb|ESQ28618.1| hypothetical protein EUTSA_v10019820mg [Eutrema salsugineum] Length = 489 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKIST 122 I++LRVV+REDFSR++AERLV DI+KVL EL LP+KIS+ Sbjct: 414 ITVLRVVIREDFSRTLAERLVSDIVKVLHELDTLPSKISS 453 >gb|ESW13943.1| hypothetical protein PHAVU_008G2397001g, partial [Phaseolus vulgaris] Length = 404 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPVQET 137 +++LRVVVREDFSR++AERLV DI KV+ EL LPA++ + V T Sbjct: 317 VTVLRVVVREDFSRTLAERLVNDITKVVHELEQLPARVISSVTST 361 >gb|AAS79669.1| glutamate decarboxylase 2 [Brassica juncea] Length = 494 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKIS 119 I++LRVV+REDFSR++AERLV DI+KVL EL LP+KIS Sbjct: 414 ITVLRVVIREDFSRTLAERLVADIVKVLHELDTLPSKIS 452 >ref|XP_002285267.1| PREDICTED: glutamate decarboxylase 1 [Vitis vinifera] Length = 495 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPV 128 +++LRVVVREDFSR++AERLV DI KVL EL LPAK+S + Sbjct: 414 VTVLRVVVREDFSRTLAERLVFDITKVLHELDMLPAKLSAKI 455 >emb|CAN67952.1| hypothetical protein VITISV_028884 [Vitis vinifera] Length = 489 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPV 128 +++LRVVVREDFSR++AERLV DI KVL EL LPAK+S + Sbjct: 408 VTVLRVVVREDFSRTLAERLVFDITKVLHELDMLPAKLSAKI 449 >sp|Q07346.1|DCE_PETHY RecName: Full=Glutamate decarboxylase; Short=GAD gi|294112|gb|AAA33709.1| glutamate decarboxylase [Petunia x hybrida] gi|309680|gb|AAA33710.1| glutamate decarboxylase [Petunia x hybrida] Length = 500 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKIS 119 I++LRVV+REDFSR++AERLVRDI KVL EL LPA+++ Sbjct: 414 ITVLRVVIREDFSRTLAERLVRDIEKVLHELDTLPARVN 452 >ref|XP_002886996.1| glutamate decarboxylase 2 [Arabidopsis lyrata subsp. lyrata] gi|297332837|gb|EFH63255.1| glutamate decarboxylase 2 [Arabidopsis lyrata subsp. lyrata] Length = 494 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKIS 119 I++LRVV+REDFSR++AERLV DI+KVL EL LP+KIS Sbjct: 413 ITVLRVVIREDFSRTLAERLVVDIVKVLHELDTLPSKIS 451 >ref|XP_002327596.1| predicted protein [Populus trichocarpa] gi|566210674|ref|XP_006372416.1| glutamate decarboxylase 1 family protein [Populus trichocarpa] gi|550319039|gb|ERP50213.1| glutamate decarboxylase 1 family protein [Populus trichocarpa] Length = 496 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPV 128 +++LRVV+REDFSR++AERLV DI KVL EL LP +IST + Sbjct: 414 VTVLRVVIREDFSRTLAERLVLDIEKVLHELETLPCRISTKI 455 >gb|ABA18653.1| glutamate decarboxylase [Pinus pinaster] Length = 509 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 3 ISLLRVVVREDFSRSMAERLVRDILKVLQELAHLPAKISTPV 128 + LLRVVVREDF+RS+AERLV DI KVL EL LP+KI+ V Sbjct: 413 VKLLRVVVREDFNRSLAERLVHDIEKVLHELDTLPSKIAREV 454