BLASTX nr result
ID: Ephedra27_contig00015494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00015494 (479 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237250.1| PREDICTED: glutamate decarboxylase 4-like [S... 70 4e-10 ref|XP_006368084.1| PREDICTED: glutamate decarboxylase 3-like [S... 69 5e-10 emb|CBI26756.3| unnamed protein product [Vitis vinifera] 68 1e-09 gb|AAK38667.1|AF353615_1 glutamate decarboxylase isozyme 3 [Nico... 67 2e-09 ref|XP_006448050.1| hypothetical protein CICLE_v10015017mg [Citr... 67 3e-09 ref|XP_002521892.1| glutamate decarboxylase, putative [Ricinus c... 67 3e-09 ref|NP_001275838.1| glutamate decarboxylase-like [Citrus sinensi... 67 3e-09 gb|EOY01230.1| Glutamate decarboxylase 4 isoform 2 [Theobroma ca... 66 6e-09 gb|EOY01229.1| Glutamate decarboxylase 4 isoform 1 [Theobroma ca... 66 6e-09 ref|XP_002285267.1| PREDICTED: glutamate decarboxylase 1 [Vitis ... 65 7e-09 emb|CAN67952.1| hypothetical protein VITISV_028884 [Vitis vinifera] 65 7e-09 ref|XP_006391332.1| hypothetical protein EUTSA_v10019820mg [Eutr... 64 2e-08 ref|XP_002886996.1| glutamate decarboxylase 2 [Arabidopsis lyrat... 64 2e-08 ref|XP_002270937.1| PREDICTED: glutamate decarboxylase 1 [Vitis ... 64 2e-08 gb|AAL16126.1|AF428294_1 At1g65960/F12P19_12 [Arabidopsis thaliana] 64 2e-08 gb|AAS79669.1| glutamate decarboxylase 2 [Brassica juncea] 64 3e-08 gb|EXC05015.1| Glutamate decarboxylase 1 [Morus notabilis] 63 5e-08 ref|NP_001117556.1| glutamate decarboxylase 2 [Arabidopsis thali... 62 6e-08 ref|XP_002314749.2| glutamate decarboxylase family protein [Popu... 62 6e-08 ref|XP_006302114.1| hypothetical protein CARUB_v10020115mg [Caps... 62 6e-08 >ref|XP_004237250.1| PREDICTED: glutamate decarboxylase 4-like [Solanum lycopersicum] Length = 493 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPVEE 332 AD QHI++LRVV+REDFSR++AERLVFDI+KVL EL LPA+++ +EE Sbjct: 409 ADAQHITVLRVVIREDFSRTLAERLVFDIVKVLHELDTLPARLSAKMEE 457 >ref|XP_006368084.1| PREDICTED: glutamate decarboxylase 3-like [Solanum tuberosum] Length = 153 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/49 (65%), Positives = 43/49 (87%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPVEE 332 AD QH+++LRVV+REDFSR++AERLVFDI+KVL EL LPA+++ +EE Sbjct: 66 ADAQHVTVLRVVIREDFSRTLAERLVFDIVKVLHELDTLPARLSAKMEE 114 >emb|CBI26756.3| unnamed protein product [Vitis vinifera] Length = 462 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 475 DIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPVEET 329 D QH+++LRVVVREDFSR++AERLVFDI KVL EL LPAK++ + +T Sbjct: 410 DAQHVTVLRVVVREDFSRTLAERLVFDITKVLHELDMLPAKLSAKISKT 458 >gb|AAK38667.1|AF353615_1 glutamate decarboxylase isozyme 3 [Nicotiana tabacum] Length = 491 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPVEE 332 AD QH+++LRVV+REDFSR++AERLV DI+KVL EL LPA+++ +EE Sbjct: 409 ADAQHVTVLRVVIREDFSRTLAERLVLDIVKVLHELDTLPARLSAKLEE 457 >ref|XP_006448050.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] gi|557550661|gb|ESR61290.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] Length = 364 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPVEE 332 AD QHI++LRVV+REDFSR++AERLV DI KVL EL LP+K+ P E Sbjct: 279 ADAQHITVLRVVIREDFSRTLAERLVLDITKVLHELDSLPSKVLVPASE 327 >ref|XP_002521892.1| glutamate decarboxylase, putative [Ricinus communis] gi|223538930|gb|EEF40528.1| glutamate decarboxylase, putative [Ricinus communis] Length = 180 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPV 338 AD QHI++LRVV+REDFSR++AERLV DI KVL EL LPAKI+ V Sbjct: 87 ADAQHITVLRVVIREDFSRTLAERLVLDITKVLHELDQLPAKISAKV 133 >ref|NP_001275838.1| glutamate decarboxylase-like [Citrus sinensis] gi|567911471|ref|XP_006448049.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] gi|70609690|gb|AAZ05070.1| glutamate decarboxylase [Citrus sinensis] gi|557550660|gb|ESR61289.1| hypothetical protein CICLE_v10015017mg [Citrus clementina] Length = 494 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPVEE 332 AD QHI++LRVV+REDFSR++AERLV DI KVL EL LP+K+ P E Sbjct: 409 ADAQHITVLRVVIREDFSRTLAERLVLDITKVLHELDSLPSKVLVPASE 457 >gb|EOY01230.1| Glutamate decarboxylase 4 isoform 2 [Theobroma cacao] Length = 361 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKIN 347 AD QHI++LRVV+REDFSR++AERLV DI KVL EL LPAK+N Sbjct: 272 ADAQHITVLRVVIREDFSRTLAERLVLDIKKVLHELDTLPAKVN 315 >gb|EOY01229.1| Glutamate decarboxylase 4 isoform 1 [Theobroma cacao] Length = 498 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKIN 347 AD QHI++LRVV+REDFSR++AERLV DI KVL EL LPAK+N Sbjct: 409 ADAQHITVLRVVIREDFSRTLAERLVLDIKKVLHELDTLPAKVN 452 >ref|XP_002285267.1| PREDICTED: glutamate decarboxylase 1 [Vitis vinifera] Length = 495 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -2 Query: 475 DIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPV 338 D QH+++LRVVVREDFSR++AERLVFDI KVL EL LPAK++ + Sbjct: 410 DAQHVTVLRVVVREDFSRTLAERLVFDITKVLHELDMLPAKLSAKI 455 >emb|CAN67952.1| hypothetical protein VITISV_028884 [Vitis vinifera] Length = 489 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -2 Query: 475 DIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPV 338 D QH+++LRVVVREDFSR++AERLVFDI KVL EL LPAK++ + Sbjct: 404 DAQHVTVLRVVVREDFSRTLAERLVFDITKVLHELDMLPAKLSAKI 449 >ref|XP_006391332.1| hypothetical protein EUTSA_v10019820mg [Eutrema salsugineum] gi|557087766|gb|ESQ28618.1| hypothetical protein EUTSA_v10019820mg [Eutrema salsugineum] Length = 489 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINT 344 AD QHI++LRVV+REDFSR++AERLV DI+KVL EL LP+KI++ Sbjct: 409 ADAQHITVLRVVIREDFSRTLAERLVSDIVKVLHELDTLPSKISS 453 >ref|XP_002886996.1| glutamate decarboxylase 2 [Arabidopsis lyrata subsp. lyrata] gi|297332837|gb|EFH63255.1| glutamate decarboxylase 2 [Arabidopsis lyrata subsp. lyrata] Length = 494 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKIN 347 AD QHI++LRVV+REDFSR++AERLV DI+KVL EL LP+KI+ Sbjct: 408 ADAQHITVLRVVIREDFSRTLAERLVVDIVKVLHELDTLPSKIS 451 >ref|XP_002270937.1| PREDICTED: glutamate decarboxylase 1 [Vitis vinifera] gi|297738155|emb|CBI27356.3| unnamed protein product [Vitis vinifera] Length = 488 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 475 DIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPVEET 329 D QH+++LRVV+REDFSR++AERLV DI KVL EL LPAKI V+++ Sbjct: 410 DAQHVTVLRVVIREDFSRTLAERLVTDIQKVLYELDTLPAKITAKVQQS 458 >gb|AAL16126.1|AF428294_1 At1g65960/F12P19_12 [Arabidopsis thaliana] Length = 494 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKIN 347 AD+QHI++LRVV+REDFSR++AERLV DI KVL EL LP+KI+ Sbjct: 408 ADVQHITVLRVVIREDFSRTLAERLVADISKVLHELDTLPSKIS 451 >gb|AAS79669.1| glutamate decarboxylase 2 [Brassica juncea] Length = 494 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKIN 347 AD QHI++LRVV+REDFSR++AERLV DI+KVL EL LP+KI+ Sbjct: 409 ADAQHITVLRVVIREDFSRTLAERLVADIVKVLHELDTLPSKIS 452 >gb|EXC05015.1| Glutamate decarboxylase 1 [Morus notabilis] Length = 502 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAK 353 AD +H+SLLRVV+REDFSR++AERLV DI KVL+EL LP K Sbjct: 409 ADARHVSLLRVVIREDFSRTLAERLVIDITKVLEELDKLPTK 450 >ref|NP_001117556.1| glutamate decarboxylase 2 [Arabidopsis thaliana] gi|2494175|sp|Q42472.1|DCE2_ARATH RecName: Full=Glutamate decarboxylase 2; Short=GAD 2 gi|6227020|gb|AAF06056.1|AC009513_12 Identical to gb|U46665 glutamate decarboxylase 2 (GAD 2) Arabidopsis thaliana. ESTs gb|W43856, gb|N37724, gb|Z34642 and gb|R90491 come from this gene [Arabidopsis thaliana] gi|16226934|gb|AAL16302.1|AF428372_1 At1g65960/F12P19_12 [Arabidopsis thaliana] gi|1184960|gb|AAC33485.1| glutamate decarboxylase 2 [Arabidopsis thaliana] gi|1236619|gb|AAC31617.1| glutamate decarboxylase [Arabidopsis thaliana] gi|21700917|gb|AAM70582.1| At1g65960/F12P19_12 [Arabidopsis thaliana] gi|332196324|gb|AEE34445.1| glutamate decarboxylase 2 [Arabidopsis thaliana] Length = 494 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKIN 347 AD QHI++LRVV+REDFSR++AERLV DI KVL EL LP+KI+ Sbjct: 408 ADAQHITVLRVVIREDFSRTLAERLVADISKVLHELDTLPSKIS 451 >ref|XP_002314749.2| glutamate decarboxylase family protein [Populus trichocarpa] gi|550329553|gb|EEF00920.2| glutamate decarboxylase family protein [Populus trichocarpa] Length = 502 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKINTPV 338 AD +HI++LRVV+REDFSR++AERLV DI KVL EL LPAK++ + Sbjct: 410 ADAKHITVLRVVIREDFSRTLAERLVRDITKVLHELDSLPAKLSAKI 456 >ref|XP_006302114.1| hypothetical protein CARUB_v10020115mg [Capsella rubella] gi|482570824|gb|EOA35012.1| hypothetical protein CARUB_v10020115mg [Capsella rubella] Length = 537 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 478 ADIQHISLLRVVVREDFSRSMAERLVFDILKVLQELAHLPAKIN 347 AD QHI++LRVV+REDFSR++AERLV DI KVL EL LP+KI+ Sbjct: 451 ADAQHITVLRVVIREDFSRTLAERLVSDISKVLHELDTLPSKIS 494