BLASTX nr result
ID: Ephedra27_contig00014027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00014027 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT09826.1| hypothetical protein F775_29521 [Aegilops tauschii] 56 6e-06 gb|EMS45745.1| hypothetical protein TRIUR3_01046 [Triticum urartu] 56 6e-06 gb|ADP02167.1| DUF1764 domain-containing protein [Triticum aesti... 56 6e-06 >gb|EMT09826.1| hypothetical protein F775_29521 [Aegilops tauschii] Length = 370 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 103 KVPRRKTNDGLVIYSADELGFNKKDAGGTAL 195 K PRR+TNDGL IYSADELGF K DAGGTAL Sbjct: 331 KRPRRRTNDGLTIYSADELGFGKADAGGTAL 361 >gb|EMS45745.1| hypothetical protein TRIUR3_01046 [Triticum urartu] Length = 429 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 103 KVPRRKTNDGLVIYSADELGFNKKDAGGTAL 195 K PRR+TNDGL IYSADELGF K DAGGTAL Sbjct: 390 KRPRRRTNDGLTIYSADELGFGKADAGGTAL 420 >gb|ADP02167.1| DUF1764 domain-containing protein [Triticum aestivum] Length = 171 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 103 KVPRRKTNDGLVIYSADELGFNKKDAGGTAL 195 K PRR+TNDGL IYSADELGF K DAGGTAL Sbjct: 132 KRPRRRTNDGLTIYSADELGFGKADAGGTAL 162